VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

RplL

Gene Name RplL
Sequence Strain (Species/Organism) Brucella abortus 2308
VO ID VO_0010908
NCBI Gene ID 3788918
NCBI Protein GI 489054195
Locus Tag BAB_RS21965
Genbank Accession AM040264
Protein Accession WP_002964371
Taxonomy ID 359391
Chromosome No I
Gene Starting Position 1229918
Gene Ending Position 1230292
Gene Strand (Orientation) -
Protein Name 50S ribosomal protein L7/L12
Protein pI 4.49
Protein Weight 11356.05
Protein Length 124
Protein Note present in two forms; L12 is normal, while L7 is aminoacylated at the N-terminal serine; the only multicopy ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two L12 dimers bind L10; critically important for translation efficiency and fidelity; stimulates GTPase activity of translation factors
DNA Sequence
>NC_007618.1:1229918-1230292 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
CTTACTTGAGTTCAACCTTGGCGCCAGCAGCTTCGAGCTGTGCCTTGATCTTCTCAGCTTCGTCCTTCGA
GGCGCCTTCCTTGACAGCCTTCGGAGCGCCTTCGACCAGGTCCTTGGCTTCCTTGAGGCCGAGACCGGTG
AGTGCGCGCACTTCCTTGATCACGTTGATCTTGTTAGCGCCGCCGTCAGCGAGAACGACGTCGAATTCGG
TCTTTTCTTCTGCGGCAGCAGCAGGGGCAGCGCCACCGGCAGCAGCAACAGCGACCGGAGCAGCAGCCGA
AACGCCCCACTTCTCTTCGAGAAGCTTGGACAGCTCAGCGGCTTCCAGAACGGTCAGGGCCGAAAGGTCT
TCAACGATCTTTGCGAGATCAGCCA

Protein Sequence
>WP_002964371.1 MULTISPECIES: 50S ribosomal protein L7/L12 [Brucella]
MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDVVLADGGANKI
NVIKEVRALTGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAGAKVELK

Molecule Role Protective antigen
Molecule Role Annotation Study was designed to evaluate the immunogenicity and the protective efficacy of a divalent fusion DNA vaccine encoding both the Brucella abortus L7/L12 protein (ribosomal protein, rplL) and Omp16 protein (outer membrane lipoprotein). This divalent DNA vaccine induced a significant level of protection against challenge with the virulent B. abortus in BALB/c mice (Luo et al., 2006b).
Related Vaccines(s) B. abortus DNA vaccine encoding RplL and Omp16
References