VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

HA

Gene Name HA
Sequence Strain (Species/Organism) Influenza A virus (A/equine/Kentucky/1/1981(H3N8))
VO ID VO_0011302
NCBI Nucleotide GI 166079523
NCBI Protein GI 166079524
Protein Accession ABY81481.1
Other Database IDs CDD:278910
Taxonomy ID 475467
Gene Strand (Orientation) ?
Protein Name hemagglutinin
Protein pI 7.98
Protein Weight 61820.7
Protein Length 654
Protein Note Haemagglutinin; pfam00509
DNA Sequence
>gi|166079523|gb|CY028828.1| Influenza A virus (A/equine/Kentucky/1/1981(H3N8)) segment 4, complete sequence
TCTGTCAATCATGAAGACAACCATTATTTTGATACTACTGACCCATTGGGTCTACAGTCAAAACCCAACC
AGTGGCAACAACACAGCCACACTATGTCTGGGACACCATGCAGTAGCAAATGGAACATTGGTAAAAACAA
TAACTGATGACCAAATTGAGGTGACAAATGCTACTGAATTAGTTCAGAGCACTTCAATAGGGAAAATATG
CAACAACCCATATAGGGTTCTAGATGGAAGAAACTGCACATTAATAGATGCAATGCTAGGAGATCCCCAC
TGTGATGTTTTTCAGTATGAGAATTGGGACCTCTTCATAGAAAGAAGCAGCGCTTTCAGCAATTGCTACC
CATATGACATCCCTGACTATGCATCGCTCCGGTCTATTGTGGCATCTTCAGGAACATTAGAATTCACAGC
AGAGGGATTCACATGGACAGGTGTCACTCAAAACGGAAGAAGTGGAGCCTGCAGAAGGGGGTCAGCCGAT
AGTTTCTTTAGCCGACTGAATTGGCTAACAAAATCTGGAAATTCTTACCCCACATTGAATGTAACAATGC
CTAACAATAACAATTTCGATAAACTATACATCTGGGGGATCCATCACCCGAGCACAAACAATGAGCAGAC
AAAATTGTATATCCAAGAATCAGGGCGAGTAACAGTCTCAACAAAAAGAAGTCAACAAACAATAATCCCC
AACATCGGATCTAGACCGTGGGTCAGGGGTCAATCAGGCAGGATAAGCATATATTGGACCATTGTGAAAC
CTGGAGATATCCTAATGATAAACAGTAATGGCAACTTAGTTGCACCGCGGGGATATTTTAAAATGCGAAC
AGGGAAAAGCTCTGTAATGAGATCAGATGCACCCATAGACACTTGTGTGTCCGAGTGTATTACACCAAAT
GGAAGCATCCCCAACGACAAACCATTTCAAAATGTGAACAAAGTTACATATGGAAAATGCCCCAAGTATA
TCAAGCAGAATACTTTGAAGCTGGCCACTGGGATGAGGAATGTACCAGAAAAGCAAATCAGAGGAATCTT
TGGAGCAATAGCGGGATTCATAGAAAACGGCTGGGAAGGAATGGTTGATGGGTGGTATGGATTCCGATAT
CAGAATTCGGAAGGAACAGGACAAGCTGCAGATCTAAAGAGCACTCAAGCAGCCATCGACCAGATCAATG
GAAAATTGAACAGAGTGATTGAAAGGACCAATGAGAAATTCCATCAAATAGAGAAGGAATTCTCAGAAGT
AGAAGGGAGAATCCAGGACTTGGAGAAGTATGTAGAAGACACCAAAATAGACCTATGGTCCTACAATGCA
GAGTTACTGGTGGCTCTAGAAAATCAACATACGATTGACTTAACAGATGCAGAAATGAATAAATTATTCG
AGAAGACTAGGCGCCAGTTAAGAGAAAACGCGGAAGACATGGGGGGTGGATGTTTCAAGATTTATCACAA
ATGTGATAATGCATGCATTGGATCAATAAGAAATGGGACATATGACCATTACATATACAGAGATGAAGCA
TTAAACAACCGATTTCAAATTAAAGGTGTTGAATTGAAATCAGGCTACAAAGATTGGATACTGTGGATTT
CATTCGCCATATCATGCTTCTTAATTTGCGTTGTTCTATTGGGTTTCATCATGTGGGCTTGCCAAAAAGG
CAACATCAGATGCAACATTTGCATTTGAGTAAACTGATAGTTAAA
Protein Sequence
>ABY81481.1 hemagglutinin [Influenza A virus (A/equine/Kentucky/1/1981(H3N8))]
MKTTIILILLTHWVYSQNPTSGNNTATLCLGHHAVANGTLVKTITDDQIEVTNATELVQSTSIGKICNNP
YRVLDGRNCTLIDAMLGDPHCDVFQYENWDLFIERSSAFSNCYPYDIPDYASLRSIVASSGTLEFTAEGF
TWTGVTQNGRSGACRRGSADSFFSRLNWLTKSGNSYPTLNVTMPNNNNFDKLYIWGIHHPSTNNEQTKLY
IQESGRVTVSTKRSQQTIIPNIGSRPWVRGQSGRISIYWTIVKPGDILMINSNGNLVAPRGYFKMRTGKS
SVMRSDAPIDTCVSECITPNGSIPNDKPFQNVNKVTYGKCPKYIKQNTLKLATGMRNVPEKQIRGIFGAI
AGFIENGWEGMVDGWYGFRYQNSEGTGQAADLKSTQAAIDQINGKLNRVIERTNEKFHQIEKEFSEVEGR
IQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDAEMNKLFEKTRRQLRENAEDMGGGCFKIYHKCDN
ACIGSIRNGTYDHYIYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLICVVLLGFIMWACQKGNIR
CNICI

Molecule Role Protective antigen
Molecule Role Annotation Skin and mucosal vaccination of ponies with HA from influenza virus A/equine/Ky/1/81 provided complete protection from clinical signs of infection after challenge, while skin vaccination provided partial protection; DNA vaccination provided partial protection from viral shedding (Lunn et al., 1999).
Related Vaccines(s) Influenza virus DNA vaccine BacPAKHA encoding EqfKY HA , Influenza virus DNA vaccine encoding HA from Influenza A virus (A/equine/Kentucky/1/1981(H3N8))
References