VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

E1

Gene Name E1
Sequence Strain (Species/Organism) Western equine encephalomyelitis virus
VO ID VO_0011306
NCBI Nucleotide GI 17148716
NCBI Protein GI 17148717
Protein Accession AAL35792.1
Other Database IDs CDD:279870
Taxonomy ID 11039
Gene Strand (Orientation) ?
Protein Name glycoprotein
Protein pI 6.22
Protein Weight 33702.07
Protein Length 411
Protein Note Alphavirus E1 glycoprotein; pfam01589
DNA Sequence
>gi|17148716|gb|AF398393.1| Western equine encephalomyelitis virus glycoprotein (E1) mRNA, partial cds
AGACGCACAGTGCTTTTGTGACAGCGAGAACACGCAACTAAGCGAAGCATATGTCGAGTTTGCTCCAGAT
TGCACTGTAGATCACGCAGTCGCTTTAAAAGTTCACACAGCTGCTTTGAAAGTCAGCCTGCGCATAGTAT
ATGGCAATACCACCGCGCGCCTGGATACGTTCGTTAATGGCGTCACACCAGGTTCCACGCGAGACCTGAA
GGTCATCGCAGGGCCGATATCAGCCGCTTTTTCGCCCTTTGACCATAAAGTCGTTATTAGAAAAGGGCTT
GTCTACAACTATGACTTTCCAGAGTACGGAGCCATGAGACCAGGTGTGTTCGGCGATATTCAAGCATCTT
CGCTAGACGCCAAGGACATAGTAGCCCGCACTGACATACGGCTGCTGAAGCCTTCTGTCAAGAACATCCA
TGTTCCTTACACCCAAGCAGTGTCAGGGTATGAAATGTGGAAGAACAATTCAGGACGGCCACTGCAAGAA
ACGGCACCGTTTGGCTGTAAAATCGAAGTGGAGCCTTTGCGAGCGTCTGATTGCGCTTATGGGCACATCC
CTATCTCAATCGATATTCCTGACGCAGCTTTCGTGAGATCATCAGAGTCACCTACAATTCTAGAAGTCAG
CTGCTCGGTAGCAGACTGCATCTATTCGGCAGACTTTGGAGGCTCACTGACACTACAGTACAAAGCTGAC
AGGGAGGGACACTGTCCAGTTCACTCTCACTCCACTACAGCTGTCTTGAAGGAAGCGACCACACACGTGA
CTGCCATAGGCAGCATAACGCTACATTTCAGTACATCAAGCCCACAAGCAAATTTTATAATTTCGCTGTG
TGGCAAGAAGACTACTTGCAATGCTGAATGCAAACCACCAGAGGACCACATAATTGGTGAACCACACAAG
GTTGACCAGGAATTCCAGGCGGCAGTTTCTAAAACATCCTGGAACTGGCTCGTCGCGCTGTTTGGGGGAG
CATCATCCCTCATTGTTGTAGGACT
Protein Sequence
>AAL35792.1 glycoprotein, partial [Western equine encephalitis virus]
DAQCFCDSENTQLSEAYVEFAPDCTVDHAVALKVHTAALKVSLRIVYGNTTARLDTFVNGVTPGSTRDLK
VIAGPISAAFSPFDHKVVIRKGLVYNYDFPEYGAMRPGVFGDIQASSLDAKDIVARTDIRLLKPSVKNIH
VPYTQAVSGYEMWKNNSGRPLQETAPFGCKIEVEPLRASDCAYGHIPISIDIPDAAFVRSSESPTILEVS
CSVADCIYSADFGGSLTLQYKADREGHCPVHSHSTTAVLKEATTHVTAIGSITLHFSTSSPQANFIISLC
GKKTTCNAECKPPEDHIIGEPHKVDQEFQAAVSKTSWNWLVALFGGASSLIVVGL

Molecule Role Protective antigen
Molecule Role Annotation DNA vaccines encoding different portions of the structural proteins of western equine encephalitis virus were tested for the efficacy of their protection in a 100% lethal mouse model of the virus. The 6K-E1 structural protein encoded by the DNA vaccine conferred complete protection against challenge with the homologous strain and limited protection against challenge with a heterologous strain (Gauci et al., 2010).

Note: The E1 glycoprotein is part of the 6K-E1 structural protein
Additional Molecule Role Virmugen
Additional Molecule Role Annotation A PE2 mutant combined with a deletion in E1 (WE2130) induced low-level viremia in chickens and protected against challenge with wild type WEE after 2 weeks. This study also found that it is unlikely that mosquito transmission of this strain would occur (Turell et al., 2003).
Related Vaccines(s) WEEV DNA Vaccine encoding 6K-E1 Protein , Western equine encephalomyelitis virus PE2/E1 mutant vaccine
References