VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

6K

Gene Name 6K
Sequence Strain (Species/Organism) Western equine encephalomyelitis virus
VO ID VO_0011307
NCBI Protein GI 29611993
Other Database IDs CDD:279870
Taxonomy ID 11039
Gene Strand (Orientation) ?
Protein Name 6K protein
Protein pI 7.08
Protein Weight 6303.88
Protein Length 117
Protein Note Alphavirus E1 glycoprotein; pfam01589
Protein Sequence
>NP_818941.1 6K protein [Western equine encephalitis virus]
ETFGETLNHLWFNNQPFLWAQLCIPLAALVILFRCFSCCMPFLLVAGVCLGKVDA

Molecule Role Protective antigen
Molecule Role Annotation DNA vaccines encoding different portions of the structural proteins of western equine encephalitis virus were tested for the efficacy of their protection in a 100% lethal mouse model of the virus. The 6K-E1 structural protein encoded by the DNA vaccine conferred complete protection against challenge with the homologous strain and limited protection against challenge with a heterologous strain (Gauci et al., 2010).

Note: The 6K protein is part of the 6K-E1 structural protein
Related Vaccines(s) WEEV DNA Vaccine encoding 6K-E1 Protein
References