VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

TSA

Gene Name TSA
VO ID VO_0011338
NCBI Protein GI 62175539
Other Database IDs CDD:271234
CDD:290570
Taxonomy ID 5691
Gene Strand (Orientation) ?
Protein Name trans-sialidase
Protein pI 6.57
Protein Weight 77957.172
Protein Length 833
Protein Note Non-viral sialidases; cd15482
Protein Sequence
>AAX69677.1 trans-sialidase [Trypanosoma brucei]
MEELHQQMRMPISRLLLIFTAVCHCCALTSKAAGKGTTREAFLSGGAWALRKKLSEKDGEVWWWQDGPNW
KDKYDKEWERWFKEEKGPWGGSEKRSEWFARMTGGYITLGKTKILSSAIEGSDKVERTVHSFRIPSFVEV
DGVLMGIGDARYLTSTDYFFTDTVAKYSADGGKTWKTEVIIENGRVDPTYSRVVDPTVVAKADSVFVLVA
RYNVTKGYWHNENNAAGIADWEPFMYKGVVTKGADGKTSDVRISWTKTPLKPLYDFTVAGSKGTQFIGGA
GNGVVTLNGTILFPVQARNEDNAVVSMVMYSVDDGVSWHFARGETALLTSEASLTEWNGKLLMSARTDTS
GVNVEGGFRKVFESNNLGATWEESLGTISRVIGNSPDRTKPSPTANYPGSSGALITVTLGDVPVMLITHP
KNTKGAWSRDRLQLWMTDGNRMWLVGQISEGDDNSAYSSLLLARDGLLYCLHEQNIDEVYGLHLVHLVDE
LEKVNATVRKWKAQDALLAGLCSSSRKKNDPTCSGVPTDGLVGLLAGPVGASVWADVYDCVNASISDGVK
VSEGVQLGGKRNSRVLWPVSEQGQDQRYYFANTHFTLLATVRFAGEPKAEAPLMGFSNAEGKTSETLSLT
VGGKKWVLTYGSVRKEGPTTSMDWNQTHQIALTLRDGKVDAHVNGELIIKEVSVGASESSAHLHLSHFFI
GAPVNDSGEGGNNVIVRNVLLYNRKLDEDELQLLYSNREKIQPVVSAVGIPEGMSAPRLCCLLILMYVLA
I

Molecule Role Protective antigen
Molecule Role Annotation BALB-c mice immunized intramuscularly with a single dose (100 microg) of a plasmid DNA encoding the 5'-terminal region of the trans-sialidase (nTSA) gene of T. brucei brucei are able to produce IgG antibodies that bind to the bloodstream form of T. brucei-protein extract and recognize the recombinant nTSA protein, expressed in Escherichia coli. Furthermore, this DNA vaccination process was able to protect 60% of mice submitted to a challenge assay with the infective form of T. brucei brucei parasites (Silva et al., 2009).
Related Vaccines(s) T. brucei DNA Vaccine encoding TSA protein
References