VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PE20

Gene Name PE20
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0012371
NCBI Gene ID 885537
NCBI Protein GI 57116919
Locus Tag Rv1806
Genbank Accession JLDD01000021
Protein Accession YP_177843
Taxonomy ID 83332
Gene Starting Position 2048071
Gene Ending Position 2048370
Gene Strand (Orientation) +
Protein Name PE family protein PE20
Protein pI 4.19
Protein Weight 8927.3
Protein Length 99
Protein Note Rv1806, (MTV049.28), len: 99 aa. Member of the Mycobacterium tuberculosis PE family of gly-, ala-rich proteins (see citation below), most similar to Rv1788|MTV049.10|AL022021 (99 aa), FASTA scores: opt: 334, E(): 4.7 e-15, (59.8% identity in 97 aa overlap). TBparse score is 0.932.
DNA Sequence
>NC_000962.3:2048071-2048370 Mycobacterium tuberculosis H37Rv, complete genome
CATGGCGTTTGTTCTTGTCTGTCCAGATGCGCTGGCCATCGCGGCCGGTCAGTTGCGCCATGTTGGATCG
GTGATAGCCGCGCGGAATGCGGTCGCGGCACCGGCAACTGCCGAATTGGCCCCGGCGGCCGCTGACGAAG
TATCAGCTTTGACTGCAACACAATTCAACTTCCATGCCGCCATGTACCAAGCGGTCGGCGCCCAGGCGAT
CGCCATGAATGAGGCGTTCGTCGCGATGTTGGGCGCCAGCGCGGATTCTTACGCGGCTACCGAAGCCGCC
AACATCATTGCTGTGAGCTA

Protein Sequence
>YP_177843.1 PE family protein PE20 [Mycobacterium tuberculosis H37Rv]
MAFVLVCPDALAIAAGQLRHVGSVIAARNAVAAPATAELAPAAADEVSALTATQFNFHAAMYQAVGAQAI
AMNEAFVAMLGASADSYAATEAANIIAVS

Molecule Role Protective antigen
Molecule Role Annotation A selection of previously identified protective Mycobacterium tuberculosis DNA vaccines were re-formulated as proteins and administered with a Th1-inducing adjuvant to help stimulate the relevant immune responses necessary for protection. One candidate (Rv1806-1807) induced protection in the guinea pig aerosol infection model 30 days post-challenge on the basis of reducing the bacterial burden of M. tuberculosis in the lungs (Vipond et al., 2006).
Related Vaccines(s) DNA vaccine Rv1806-1807
References