VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PPE31

Gene Name PPE31
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0012372
NCBI Gene ID 885072
NCBI Protein GI WP_003409179
Locus Tag Rv1807
Genbank Accession AL123456
Protein Accession YP_177653
Other Database IDs CDD:227938
Taxonomy ID 1763
Gene Starting Position 2048397
Gene Ending Position 2049596
Gene Strand (Orientation) +
Protein Name PPE family protein
Protein pI 4.1
Protein Weight 39253.11
Protein Length 475
Protein Note PPE-repeat protein [Function unknown]
DNA Sequence
>NC_000962.3:2048397-2049596 Mycobacterium tuberculosis H37Rv, complete genome
ACTTGACTTCGCCACGCTACCGCCCGAAATCAACTCGGCGCGTATGTATTCCGGCGCGGGCTCGGCCCCG
ATGCTGGCCGCAGCGTCAGCCTGGCACGGCTTGTCCGCAGAACTGCGCGCCAGCGCACTGTCATACAGCT
CGGTGCTTTCGACGCTGACCGGTGAAGAATGGCACGGTCCGGCGTCGGCATCGATGACAGCCGCGGCCGC
CCCCTACGTGGCCTGGATGAGCGTCACCGCCGTCCGGGCCGAGCAGGCCGGGGCACAGGCGGAGGCTGCC
GCTGCAGCGTACGAAGCCGCGTTCGCAGCAACGGTGCCCCCGCCGGTCATCGAGGCCAACCGCGCCCAGC
TCATGGCGCTGATCGCCACCAATGTGCTAGGCCAAAACGCCCCCGCGATCGCGGCCACCGAGGCCCAGTA
CGCCGAAATGTGGTCCCAGGACGCGATGGCCATGTACGGCTACGCCGGCGCCTCGGCAGCCGCTACCCAG
CTGACCCCGTTCACCGAGCCGGTGCAGACTACCAACGCGTCCGGCCTGGCGGCCCAGTCGGCTGCGATTG
CCCACGCCACCGGCGCCTCGGCTGGTGCTCAGCAAACGACGCTGTCGCAGCTGATCGCCGCCATACCGTC
TGTACTGCAAGGACTTTCGTCATCGACTGCAGCCACGTTCGCGTCGGGGCCGTCCGGATTGCTGGGCATT
GTCGGGTCTGGATCTTCCTGGCTCGACAAACTCTGGGCGTTACTGGACCCCAACTCCAATTTCTGGAACA
CGATAGCTTCGTCCGGACTGTTCTTGCCGAGTAACACGATTGCGCCCTTTTTGGGTCTACTCGGCGGCGT
GGCAGCTGCGGATGCGGCCGGGGATGTGTTGGGAGAGGCCACCAGTGGCGGGCTCGGTGGCGCGCTGGTG
GCGCCGCTTGGCTCAGCGGGCGGGCTAGGCGGCACTGTCGCGGCCGGCCTGGGCAACGCGGCCACCGTCG
GAACCTTGTCGGTGCCGCCGAGCTGGACGGCGGCCGCACCACTAGCCAGCCCCTTGGGCTCCGCGTTGGG
AGGCACACCGATGGTGGCACCGCCCCCAGCAGTGGCGGCCGGCATGCCCGGAATGCCTTTCGGCACCATG
GGCGGTCAAGGCTTCGGGCGTGCCGTGCCCCAGTATGGCTTCCGCCCCAACTTCGTCGCACGACCGCCCG
CCGCCGGGTG
Protein Sequence
>WP_003409179.1 MULTISPECIES: PPE family protein [Mycobacterium]
MTAALDFATLPPEINSARMYSGAGSAPMLAAASAWHGLSAELRASALSYSSVLSTLTGEEWHGPASASMT
AAAAPYVAWMSVTAVRAEQAGAQAEAAAAAYEAAFAATVPPPVIEANRAQLMALIATNVLGQNAPAIAAT
EAQYAEMWSQDAMAMYGYAGASAAATQLTPFTEPVQTTNASGLAAQSAAIAHATGASAGAQQTTLSQLIA
AIPSVLQGLSSSTAATSASGPSGLLGILGSGSSWLDKLWALLDPNSNFWNTIASSGLFLPSNTIAPFLGL
LGGVAAADAAGDVLGEATSGGLGGALVAPLGSAGGLGGTVAAGLGNAATVGTLSVPPSWTAAAPLASPLG
SALGGTPMVAPPPAVAAGMPGMPFGTMGGQGFGRAVPQYGFRPNFVARPPAAG
Molecule Role Protective antigen
Molecule Role Annotation A selection of previously identified protective Mycobacterium tuberculosis DNA vaccines were re-formulated as proteins and administered with a Th1-inducing adjuvant to help stimulate the relevant immune responses necessary for protection. One candidate (Rv1806-1807) induced protection in the guinea pig aerosol infection model 30 days post-challenge on the basis of reducing the bacterial burden of M. tuberculosis in the lungs (Vipond et al., 2006).
Related Vaccines(s) DNA vaccine Rv1806-1807
References