VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

eba-175

Gene Name eba-175
Sequence Strain (Species/Organism) Plasmodium falciparum 3D7
VO ID VO_0012382
NCBI Gene ID 2654998
NCBI Protein GI 296004911
Locus Tag PF3D7_0731500
Genbank Accession AL844506
Protein Accession XP_001349207
Taxonomy ID 36329
Chromosome No 7
Gene Starting Position 1358054
Gene Ending Position 1362928
Gene Strand (Orientation) +
Protein pI 5.47
Protein Weight 168527.84
Protein Length 1502
Protein Note Also known as eba 175; eba175
DNA Sequence
>NC_004328.3:1358054-1362928 Plasmodium falciparum 3D7 chromosome 7
AATGAAATGTAATATTAGTATATATTTTTTTGCTTCCTTCTTTGTGTTATATTTTGCAAAAGCTAGGAAT
GAATATGATATAAAAGAGAATGAAAAATTTTTAGACGTGTATAAAGAAAAATTTAATGAATTAGATAAAA
AGAAATATGGAAATGTTCAAAAAACTGATAAGAAAATATTTACTTTTATAGAAAATAAATTAGATATTTT
AAATAATTCAAAATTTAATAAAAGATGGAAGAGTTATGGAACTCCAGATAATATAGATAAAAATATGTCT
TTAATAAATAAACATAATAATGAAGAAATGTTTAACAACAATTATCAATCATTTTTATCGACAAGTTCAT
TAATAAAGCAAAATAAATATGTTCCTATTAACGCTGTACGTGTGTCTAGGATATTAAGTTTCCTGGATTC
TAGAATTAATAATGGAAGAAATACTTCATCTAATAACGAAGTTTTAAGTAATTGTAGGGAAAAAAGGAAA
GGAATGAAATGGGATTGTAAAAAGAAAAATGATAGAAGCAACTATGTATGTATTCCTGATCGTAGAATCC
AATTATGCATTGTTAATCTTAGCATTATTAAAACATATACAAAAGAGACCATGAAGGATCATTTCATTGA
AGCCTCTAAAAAAGAATCTCAACTTTTGCTTAAAAAAAATGATAACAAATATAATTCTAAATTTTGTAAT
GATTTGAAGAATAGTTTTTTAGATTATGGACATCTTGCTATGGGAAATGATATGGATTTTGGAGGTTATT
CAACTAAGGCAGAAAACAAAATTCAAGAAGTTTTTAAAGGGGCTCATGGGGAAATAAGTGAACATAAAAT
TAAAAATTTTAGAAAAAAATGGTGGAATGAATTTAGAGAGAAACTTTGGGAAGCTATGTTATCTGAGCAT
AAAAATAATATAAATAATTGTAAAAATATTCCCCAAGAAGAATTACAAATTACTCAATGGATAAAAGAAT
GGCATGGAGAATTTTTGCTTGAAAGAGATAATAGATCAAAATTGCCAAAAAGTAAATGTAAAAATAATAC
ATTATATGAAGCATGTGAGAAGGAATGTATTGATCCATGTATGAAATATAGAGATTGGATTATTAGAAGT
AAATTTGAATGGCATACGTTATCGAAAGAATATGAAACTCAAAAAGTTCCAAAGGAAAATGCGGAAAATT
ATTTAATCAAAATTTCAGAAAACAAGAATGATGCTAAAGTAAGTTTATTATTGAATAATTGTGATGCTGA
ATATTCAAAATATTGTGATTGTAAACATACTACTACTCTCGTTAAAAGCGTTTTAAATGGTAACGACAAT
ACAATTAAGGAAAAGCGTGAACATATTGATTTAGATGATTTTTCTAAATTTGGATGTGATAAAAATTCCG
TTGATACAAACACAAAGGTGTGGGAATGTAAAAAACCTTATAAATTATCCACTAAAGATGTATGTGTACC
TCCGAGGAGGCAAGAATTATGTCTTGGAAACATTGATAGAATATACGATAAAAACCTATTAATGATAAAA
GAGCATATTCTTGCTATTGCAATATATGAATCAAGAATATTGAAACGAAAATATAAGAATAAAGATGATA
AAGAAGTTTGTAAAATCATAAATAAAACTTTCGCTGATATAAGAGATATTATAGGAGGTACTGATTATTG
GAATGATTTGAGCAATAGAAAATTAGTAGGAAAAATTAACACAAATTCAAATTATGTTCACAGGAATAAA
CAAAATGATAAGCTTTTTCGTGATGAGTGGTGGAAAGTTATTAAAAAAGATGTATGGAATGTGATATCAT
GGGTATTCAAGGATAAAACTGTTTGTAAAGAAGATGATATTGAAAATATACCACAATTCTTCAGATGGTT
TAGTGAATGGGGTGATGATTATTGCCAGGATAAAACAAAAATGATAGAGACTCTGAAGGTTGAATGCAAA
GAAAAACCTTGTGAAGATGACAATTGTAAACGTAAATGTAATTCATATAAAGAATGGATATCAAAAAAAA
AAGAAGAGTATAATAAACAAGCCAAACAATACCAAGAATATCAAAAAGGAAATAATTACAAAATGTATTC
TGAATTTAAATCTATAAAACCAGAAGTTTATTTAAAGAAATACTCGGAAAAATGTTCTAACCTAAATTTC
GAAGATGAATTTAAGGAAGAATTACATTCAGATTATAAAAATAAATGTACGATGTGTCCAGAAGTAAAGG
ATGTACCAATTTCTATAATAAGAAATAATGAACAAACTTCGCAAGAAGCAGTTCCTGAGGAAAGCACTGA
AATAGCACACAGAACGGAAACTCGTACGGATGAACGAAAAAATCAGGAACCAGCAAATAAGGATTTAAAG
AATCCACAACAAAGTGTAGGAGAGAACGGAACTAAAGATTTATTACAAGAAGATTTAGGAGGATCACGAA
GTGAAGACGAAGTGACACAAGAATTTGGAGTAAATCATGGAATACCTAAGGGTGAGGATCAAACGTTAGG
AAAATCTGACGCCATTCCAAACATAGGCGAACCCGAAACGGGAATTTCCACTACAGAAGAAAGTAGACAT
GAAGAAGGCCACAATAAACAAGCATTGTCTACTTCAGTCGATGAGCCTGAATTATCTGATACACTTCAAT
TGCATGAAGATACTAAAGAAAATGATAAACTACCCCTAGAATCATCTACAATCACATCTCCTACGGAAAG
TGGAAGTTCTGATACAGAGGAAACTCCATCTATCTCTGAAGGACCAAAAGGAAATGAACAAAAAAAACGT
GATGACGATAGTTTGAGTAAAATAAGTGTATCACCAGAAAATTCAAGACCTGAAACTGATGCTAAAGATA
CTTCTAACTTGTTAAAATTAAAAGGAGATGTTGATATTAGTATGCCTAAAGCAGTTATTGGGAGCAGTCC
TAATGATAATATAAATGTTACTGAACAAGGGGATAATATTTCCGGGGTGAATTCTAAACCTTTATCTGAT
GATGTACGTCCAGATAAAAATCATGAAGAGGTGAAAGAACATACTAGTAATTCTGATAATGTTCAACAGT
CTGGAGGAATTGTTAATATGAATGTTGAGAAAGAACTAAAAGATACTTTAGAAAATCCTTCTAGTAGCTT
GGATGAAGGAAAAGCACATGAAGAATTATCAGAACCAAATCTAAGCAGTGACCAAGATATGTCTAATACA
CCTGGACCTTTGGATAACACCAGTGAAGAAACTACAGAAAGAATTAGTAATAATGAATATAAAGTTAACG
AGAGGGAAGGTGAGAGAACGCTTACTAAGGAATATGAAGATATTGTTTTGAAAAGTCATATGAATAGAGA
ATCAGACGATGGTGAATTATATGACGAAAATTCAGACTTATCTACTGTAAATGATGAATCAGAAGACGCT
GAAGCAAAAATGAAAGGAAATGATACATCTGAAATGTCGCATAATAGTAGTCAACATATTGAGAGTGATC
AACAGAAAAACGATATGAAAACTGTTGGTGATTTGGGAACCACACATGTACAAAACGAAATTAGTGTTCC
TGTTACAGGAGAAATTGATGAAAAATTAAGGGAAAGTAAAGAATCAAAAATTCATAAGGCTGAAGAGGAA
AGATTAAGTCATACAGATATACATAAAATTAATCCTGAAGATAGAAATAGTAATACATTACATTTAAAAG
ATATAAGAAATGAGGAAAACGAAAGACACTTAACTAATCAAAACATTAATATTAGTCAAGAAAGGGATTT
GCAAAAACATGGATTCCATACCATGAATAATCTACATGGAGATGGAGTTTCCGAAAGAAGTCAAATTAAT
CATAGTCATCATGGAAACAGACAAGATCGGGGGGGAAATTCTGGGAATGTTTTAAATATGAGATCTAATA
ATAATAATTTTAATAATATTCCAAGTAGATATAATTTATATGATAAAAAATTAGATTTAGATCTTTATGA
AAACAGAAATGATAGTACAACAAAAGAATTAATAAAGAAATTAGCAGAAATAAATAAATGTGAGAACGAA
ATTTCTGTAAAATATTGTGACCATATGATTCATGAAGAAATCCCATTAAAAACATGCACTAAAGAAAAAA
CAAGAAATCTGTGTTGTGCAGTATCAGATTACTGTATGAGCTATTTTACATATGATTCAGAGGAATATTA
TAATTGTACGAAAAGGGAATTTGATGATCCATCTTATACATGTTTCAGAAAGGAGGCTTTTTCAAGTATG
ATATTCAAATTTTTAATAACAAATAAAATATATTATTATTTTTATACTTACAAAACTGCAAAAGTAACAA
TAAAAAAAATTAATTTCTCATTAATTTTTTTTTTCTTTTTTTCTTTTTAGGTATGCCATATTATGCAGGA
GCAGGTGTGTTATTTATTATATTGGTTATTTTAGGTGCTTCACAAGCCAAATATCAAAGGTTAGAAAAAA
TAAATAAAAATAAAATTGAGAAGAATGTAAATTAAATATATATATATATATATATATATATATATTGTAT
TATATATTTTTTTTTTATAGTTCTGAAGGAGTTATGAATGAGAATAATGAGAATAATTTTTTATTTGAAG
TTACTGATAATTTAGATAAATTATCCAATATGTGTAATACAAATATAAAAAAAAATAATAAATAAATAAA
TAATTACAAGGAAATAAAAATGATATATATTATTACATTATGTTTGTTTACTTTTATATTATCCTATAAT
ATTTATTTTTATTTTATGTTTTTTTTTTTTCAGTCAATCAACAAGTACAGGAAACTAATATCAACGATTT
TTCTGAATACCATGAGGATATAAATGATATTAATTTTAAGAAATG

Protein Sequence
>XP_001349207.2 erythrocyte binding antigen-175 [Plasmodium falciparum 3D7]
MKCNISIYFFASFFVLYFAKARNEYDIKENEKFLDVYKEKFNELDKKKYGNVQKTDKKIFTFIENKLDIL
NNSKFNKRWKSYGTPDNIDKNMSLINKHNNEEMFNNNYQSFLSTSSLIKQNKYVPINAVRVSRILSFLDS
RINNGRNTSSNNEVLSNCREKRKGMKWDCKKKNDRSNYVCIPDRRIQLCIVNLSIIKTYTKETMKDHFIE
ASKKESQLLLKKNDNKYNSKFCNDLKNSFLDYGHLAMGNDMDFGGYSTKAENKIQEVFKGAHGEISEHKI
KNFRKKWWNEFREKLWEAMLSEHKNNINNCKNIPQEELQITQWIKEWHGEFLLERDNRSKLPKSKCKNNT
LYEACEKECIDPCMKYRDWIIRSKFEWHTLSKEYETQKVPKENAENYLIKISENKNDAKVSLLLNNCDAE
YSKYCDCKHTTTLVKSVLNGNDNTIKEKREHIDLDDFSKFGCDKNSVDTNTKVWECKKPYKLSTKDVCVP
PRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRILKRKYKNKDDKEVCKIINKTFADIRDIIGGTDYW
NDLSNRKLVGKINTNSNYVHRNKQNDKLFRDEWWKVIKKDVWNVISWVFKDKTVCKEDDIENIPQFFRWF
SEWGDDYCQDKTKMIETLKVECKEKPCEDDNCKRKCNSYKEWISKKKEEYNKQAKQYQEYQKGNNYKMYS
EFKSIKPEVYLKKYSEKCSNLNFEDEFKEELHSDYKNKCTMCPEVKDVPISIIRNNEQTSQEAVPEESTE
IAHRTETRTDERKNQEPANKDLKNPQQSVGENGTKDLLQEDLGGSRSEDEVTQEFGVNHGIPKGEDQTLG
KSDAIPNIGEPETGISTTEESRHEEGHNKQALSTSVDEPELSDTLQLHEDTKENDKLPLESSTITSPTES
GSSDTEETPSISEGPKGNEQKKRDDDSLSKISVSPENSRPETDAKDTSNLLKLKGDVDISMPKAVIGSSP
NDNINVTEQGDNISGVNSKPLSDDVRPDKNHEEVKEHTSNSDNVQQSGGIVNMNVEKELKDTLENPSSSL
DEGKAHEELSEPNLSSDQDMSNTPGPLDNTSEETTERISNNEYKVNEREGERTLTKEYEDIVLKSHMNRE
SDDGELYDENSDLSTVNDESEDAEAKMKGNDTSEMSHNSSQHIESDQQKNDMKTVGDLGTTHVQNEISVP
VTGEIDEKLRESKESKIHKAEEERLSHTDIHKINPEDRNSNTLHLKDIRNEENERHLTNQNINISQERDL
QKHGFHTMNNLHGDGVSERSQINHSHHGNRQDRGGNSGNVLNMRSNNNNFNNIPSRYNLYDKKLDLDLYE
NRNDSTTKELIKKLAEINKCENEISVKYCDHMIHEEIPLKTCTKEKTRNLCCAVSDYCMSYFTYDSEEYY
NCTKREFDDPSYTCFRKEAFSSMPYYAGAGVLFIILVILGASQAKYQSSEGVMNENNENNFLFEVTDNLD
KLSNMFNQQVQETNINDFSEYHEDINDINFKK

Molecule Role Protective antigen
Molecule Role Annotation 1 of 3 Monkeys vaccinated with EBA-175 was protected from challenge of parasitized erythrocytes (Sim et al., 2001).
Related Vaccines(s) P. falciparum DNA Vaccine encoding EBA-175
References