VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

phpA

Gene Name phpA
Sequence Strain (Species/Organism) Streptococcus pneumoniae
VO ID VO_0012383
NCBI Protein GI NP_358654
Other Database IDs CDD:273578
CDD:282170
CDD:293251
Taxonomy ID 171101
Gene Strand (Orientation) ?
Protein Name histidine motif-containing protein
Protein pI 5.38
Protein Weight 92561.31
Protein Length 947
Protein Note streptococcal histidine triad protein; TIGR01363
Protein Sequence
>NP_358654.1 histidine motif-containing protein [Streptococcus pneumoniae R6]
MNQIYLRKEERMKINKKYLAGSVATLVLSVCAYELGLHQAQTVKENNRVSYIDGKQATQKTENLTPDEVS
KREGINAEQIVIKITDQGYVTSHGDHYHYYNGKVPYDAIISEELLMKDPNYQLKDEDIISEIKGGYVIKV
DGKYYVYLKDAAHADNVRTKEEINRQKQEHSQHREGGTPRNDGAVALARSQGRYTTDDGYIFNASDIIED
TGDAYIVPHGDHYHYIPKNELSASELAAAKAFLSGRGNLSNSRTYRRQNSDNTSRTNWVPSVSNPGTTNT
NTSNNSNTNSQASQSNDIDSLLKQLYKLPLSQRHVESDGLIFDPAQITSRTANGVAVPHGDHYHFIPYSQ
LSPLEEKLARIIPLRYRSNHWVPDSRPEQPSPQSTPEPSPSPQPAPNPQPAPSNPIDEKLVKEAVRKVGD
GYVFEENGVPRYIPAKDLSAETAAGIDSKLAKQESLSHKLGAKKTDLPSSDREFYNKAYDLLARIHQDLL
DNKGRQVDFEALDNLLERLKDVSSDKVKLVDDILAFLAPIRHPERLGKPNAQITYTDDEIQVAKLAGKYT
TEDGYIFDPRDITSDEGDAYVTPHMTHSHWIKKDSLSEAERAAAQAYAKEKGLTPPSTDHQDSGNTEAKG
AEAIYNRVKAAKKVPLDRMPYNLQYTVEVKNGSLIIPHYDHYHNIKFEWFDEGLYEAPKGYSLEDLLATV
KYYVEHPNERPHSDNGFGNASDHVQRNKNGQADTNQTEKPNEEKPQTEKPEEETPREEKPQSEKPESPKP
TEEPEEESPEESPEESEEPQVETEKVKEKLREAEDLLGKIQNPIIKSNAKETLTGLKNNLLFGTQDNNTI
MAEAEKLLALLKESK
Molecule Role Protective antigen
Molecule Role Annotation Immunization with rPhpA-79 protein adjuvanted with monophosphoryl lipid A (for subcutaneous immunization) or a mutant cholera toxin, CT-E29H (for intranasal immunization), protected CBA/N mice against death and bacteremia, as well as reduced nasopharyngeal colonization, following intranasal challenge with a heterologous pneumococcal strain (Zhang et al., 2001).
Related Vaccines(s) S. pneumoniae PhpA-79 Protein Vaccine
References