VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

DnaK

Gene Name DnaK
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0012408
NCBI Gene ID 885946
NCBI Protein GI 15607491
Locus Tag Rv0350
Genbank Accession AL123456
Protein Accession NP_214864
Taxonomy ID 83332
Gene Starting Position 419834
Gene Ending Position 421711
Gene Strand (Orientation) +
Protein Name chaperone protein DnaK
Protein pI 4.59
Protein Weight 61176.37
Protein Length 625
Protein Note heat shock protein 70; assists in folding of nascent polypeptide chains; refolding of misfolded proteins; utilizes ATPase activity to help fold; co-chaperones are DnaJ and GrpE; multiple copies in some bacteria
DNA Sequence
>NC_000962.3:419834-421711 Mycobacterium tuberculosis H37Rv, complete genome
CATGGCTCGTGCGGTCGGGATCGACCTCGGGACCACCAACTCCGTCGTCTCGGTTCTGGAAGGTGGCGAC
CCGGTCGTCGTCGCCAACTCCGAGGGCTCCAGGACCACCCCGTCAATTGTCGCGTTCGCCCGCAACGGTG
AGGTGCTGGTCGGCCAGCCCGCCAAGAACCAGGCAGTGACCAACGTCGATCGCACCGTGCGCTCGGTCAA
GCGACACATGGGCAGCGACTGGTCCATAGAGATTGACGGCAAGAAATACACCGCGCCGGAGATCAGCGCC
CGCATTCTGATGAAGCTGAAGCGCGACGCCGAGGCCTACCTCGGTGAGGACATTACCGACGCGGTTATCA
CGACGCCCGCCTACTTCAATGACGCCCAGCGTCAGGCCACCAAGGACGCCGGCCAGATCGCCGGCCTCAA
CGTGCTGCGGATCGTCAACGAGCCGACCGCGGCCGCGCTGGCCTACGGCCTCGACAAGGGCGAGAAGGAG
CAGCGAATCCTGGTCTTCGACTTGGGTGGTGGCACTTTCGACGTTTCCCTGCTGGAGATCGGCGAGGGTG
TGGTTGAGGTCCGTGCCACTTCGGGTGACAACCACCTCGGCGGCGACGACTGGGACCAGCGGGTCGTCGA
TTGGCTGGTGGACAAGTTCAAGGGCACCAGCGGCATCGATCTGACCAAGGACAAGATGGCGATGCAGCGG
CTGCGGGAAGCCGCCGAGAAGGCAAAGATCGAGCTGAGTTCGAGTCAGTCCACCTCGATCAACCTGCCCT
ACATCACCGTCGACGCCGACAAGAACCCGTTGTTCTTAGACGAGCAGCTGACCCGCGCGGAGTTCCAACG
GATCACTCAGGACCTGCTGGACCGCACTCGCAAGCCGTTCCAGTCGGTGATCGCTGACACCGGCATTTCG
GTGTCGGAGATCGATCACGTTGTGCTCGTGGGTGGTTCGACCCGGATGCCCGCGGTGACCGATCTGGTCA
AGGAACTCACCGGCGGCAAGGAACCCAACAAGGGCGTCAACCCCGATGAGGTTGTCGCGGTGGGAGCCGC
TCTGCAGGCCGGCGTCCTCAAGGGCGAGGTGAAAGACGTTCTGCTGCTTGATGTTACCCCGCTGAGCCTG
GGTATCGAGACCAAGGGCGGGGTGATGACCAGGCTCATCGAGCGCAACACCACGATCCCCACCAAGCGGT
CGGAGACTTTCACCACCGCCGACGACAACCAACCGTCGGTGCAGATCCAGGTCTATCAGGGGGAGCGTGA
GATCGCCGCGCACAACAAGTTGCTCGGGTCCTTCGAGCTGACCGGCATCCCGCCGGCGCCGCGGGGGATT
CCGCAGATCGAGGTCACTTTCGACATCGACGCCAACGGCATTGTGCACGTCACCGCCAAGGACAAGGGCA
CCGGCAAGGAGAACACGATCCGAATCCAGGAAGGCTCGGGCCTGTCCAAGGAAGACATTGACCGCATGAT
CAAGGACGCCGAAGCGCACGCCGAGGAGGATCGCAAGCGTCGCGAGGAGGCCGATGTTCGTAATCAAGCC
GAGACATTGGTCTACCAGACGGAGAAGTTCGTCAAAGAACAGCGTGAGGCCGAGGGTGGTTCGAAGGTAC
CTGAAGACACGCTGAACAAGGTTGATGCCGCGGTGGCGGAAGCGAAGGCGGCACTTGGCGGATCGGATAT
TTCGGCCATCAAGTCGGCGATGGAGAAGCTGGGCCAGGAGTCGCAGGCTCTGGGGCAAGCGATCTACGAA
GCAGCTCAGGCTGCGTCACAGGCCACTGGCGCTGCCCACCCCGGCGGCGAGCCGGGCGGTGCCCACCCCG
GCTCGGCTGATGACGTTGTGGACGCGGAGGTGGTCGACGACGGCCGGGAGGCCAAGTG

Protein Sequence
>NP_214864.1 chaperone protein DnaK [Mycobacterium tuberculosis H37Rv]
MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSIVAFARNGEVLVGQPAKNQAVTNVDRTVRSVK
RHMGSDWSIEIDGKKYTAPEISARILMKLKRDAEAYLGEDITDAVITTPAYFNDAQRQATKDAGQIAGLN
VLRIVNEPTAAALAYGLDKGEKEQRILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDQRVVD
WLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLTRAEFQR
ITQDLLDRTRKPFQSVIADTGISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA
LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTRLIERNTTIPTKRSETFTTADDNQPSVQIQVYQGERE
IAAHNKLLGSFELTGIPPAPRGIPQIEVTFDIDANGIVHVTAKDKGTGKENTIRIQEGSGLSKEDIDRMI
KDAEAHAEEDRKRREEADVRNQAETLVYQTEKFVKEQREAEGGSKVPEDTLNKVDAAVAEAKAALGGSDI
SAIKSAMEKLGQESQALGQAIYEAAQAASQATGAAHPGGEPGGAHPGSADDVVDAEVVDDGREAK

Molecule Role Protective antigen
Molecule Role Annotation In an ex vivo transfection approach with a retroviral vector a single antigen (hsp70) could evoke strong protection in mice (Lowrie et al., 1997).
Related Vaccines(s) BCG-DHTM
References