VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

eae

Gene Name eae
Sequence Strain (Species/Organism) Escherichia coli O157:H7 str. EDL933
VO ID VO_0010944
NCBI Gene ID 960862
NCBI Protein GI WP_129935252
Locus Tag Z5110
Genbank Accession AE005174
Protein Accession NP_290259
3D structure: PDB ID 1E5U
Taxonomy ID 562
Gene Starting Position 4665440
Gene Ending Position 4668244
Gene Strand (Orientation) -
Protein Name intimin
Protein pI 9.19
Protein Weight 95549.71
Protein Length 997
Protein Note Intimin adherence protein
DNA Sequence
>NC_002655.2:4665440-4668244 Escherichia coli O157:H7 str. EDL933 genome
ATTATTCTACACAAACCGCATAGACATTTGGAGTATTAACATTAACCCCAGGAAGAGGGTTTTGTGTTAT
TAGGTTATAAGTGCTTGATACTCCAGAACGCTGCTCACTAGATGTCTGTTTAATCCAAGCAGTTATTGAG
TTCATAGAACTATAATGGCTATATTTATTTGCAGCCCCCCATGAGTCATAAATATCTGACAATACCGTCT
GTGTGGATGGTAATAAATTTTTGCAAATGGACATAGCATCAGCATAATAGGCTTGCTTATCCACTTTTAT
CATATACGACGGTGCTTTTATAGTGTAACTTACTGTTTGCTTATCACCAGATGTGGCTTTAATTACGACA
CTGCCTTTACCATTCAAAGTGACTTTCCCTGATGCATCGACAGTCGCGATACTGGTATTTTCTGAATACC
ATGAATATGTACCATCACCACCGCTTGCTTTCAGTTTAAACTGACCATATTGCAGCCAAATATTAGGCAA
CTCGCCTCTGACATTGTTACCAATAATATCAACCTTGTTGTCAATTTTCAGTTCATCAAAAAAAGTGACC
TCAGTCGCTTTAACCTCAGCCCCATCACTGACTGTCGCACTAACAGTCGCTTTACCGGCGGAACTGGAAG
TTAGTGTTATCGTCGCACGACCATCATTTCCCGTGGTTGCTTGCGTTTGAGACTTACCGTTGAACATCCC
AAAGTTTGTTGAGAATGTAACGGATTGATTATTAACTGGCTGACCGTTTTTCATAACTTTTACAGTATAT
TTAATAGCATCCTTACCATTTGCTACTGCAGTTGTCTTATCAGCCTTAATCTCAGTAATGCTGGCCTTGG
TTTGATCAAAAAATATAACCGCACTGGCATTAAGTGCTGAAGTCATCTCCGCGGTTTTAGCAGACACGAC
GACCTGTCCTGGCGTACTCGACTTCAACGTTACGGTTGCCTTACCGTTAGCATCCGTTTTGGCACTATTT
GCCCCAAGAGTTGCAGTTCCTGAAACAATATTAAATGAAACAGGGACATTAGCCTGAGCTACCCCATTCT
TTTTCACCGTCGCGGTATAAGTAATGGTATCGGCGTTATCCGCTTTAGCCGAAGTCTTATCCGCCGTAAA
GTCCGTTACCCCAACCTGGTCGACAACTTGACCATTCGACAGAACGGTAATAGTAAGCTGTACATTGTTA
GAGCTATTGCCATTACGGTCATAGGCGCGAGCCGTCACTTTATAAATATTGCTGCCACCTTGCACATAAG
CAGGCAAAATAGCCTGGTAGTCTTGTGCGCTTTGGCTTCCGCTATGCTGAATCTGACCGCCCTGACTGCG
TAATGCACTATCATCCCAGACGATACGATCCAGACCGTATTTGCTCTTAACGATCAACTGAATCTTCTGC
GTACTGTGTTCAGTACCATTAATATCATGCGGAATATTCAGAGAAAGAATATCCTGCTTCTTGTACTCCA
GAATAATATTGTTATTACGCTGAACCAGATCGTAACGGCTGCCTGATAATGTTCTTAACTCGTTAACATA
CTGTGGTTCAATTTGCTGAGACCACGATTTATCAAACTGATAACGGAACTGCATTGAGTAAAGGAGATCA
TTTTCATTACCCGTACCATGACGGTAATCGATCCCCATCGTCACCAGAGGAATCGGAGTATAGTTTACAC
CAACGGTCGCCGCACCAGGATTCGACTGCAGCTTATCAGAATTAAACAAAGCAACATTATCACCATAATA
CTGCTCATATATCAGCTTGGCGCCTAATGCCGGATATGACGGTAGATAGCCATTAAAACGGATATCGAAG
CCATTTGCTGGGCGCTCATCATAGTCTTTCTTATTGTATGACTCATGCCAGCCGCTCATGCGGAAATAGC
CGTTAACGCTACTTTTGAAATAGTCTCGCCAGTATTCGCCACCAATACCTAAACGGGTATTATCACCAGA
AAAATCCTGATCAATGAAGACGTTATAGCCCAACATGTTTGCAGGAAGGAAAAAACGCTGACCCGCACCT
AAATTTGCCGTAAAGCGGGAGTCAATGTAACGCGCTCCGACCTGACCAAATGCCAGCATTTTTTCGGAAT
CATAGAACGGTAATAAGAAGTCCAGTGAACTACCGTCAAAGTTATTACCACTCTGCAGATTAACCTCTGC
CGTTCCATAATGTTGTAACCAGGCCTGCAACTGTGACGAAGCCTGGTTACCAGCGATACCAAGAGCGGTA
TCTTTCGCGTAATCGCCGTTCAGAGATCGCGACTGAAGCTGGCTACCGAGACTCGCCGCCTGTTGTGCCG
CATAATTTAATGCCTTGTCATCGGTCATGTTGCTTTTGGTCACGTCCGGGGACATTTTAGTCAGTTTATT
CGTGTGACCAGCAACACCACCTGCAGCAACAAGAGGTGCCGAACCTAAAAGTGGTAGTGCACTGTATTCA
AAGGGAAGTTTTTTGAGTGGCAAAATGATCTGCTGACCAGGCGCGGCCTTCATCATTTCGCTTTCAGAAC
TGTATAAATGCTTATTCAACGACCAAATCGTCGATAAATTAATATCTTGCGATTTAGAAAGATCGGCAAC
AGTTTCACCAGTTTTCAACGTATAAAAAAGGCGATTCTGATAGCTATCATGAGTTAACAGTTTTGAATCC
GAACCCAATTTAAAATAATTTTCACCATTTGCAAATGAATTCTGATTAACATAAAAAAACAATCCTAAAC
CAGCACTAAGCATAATCAATGTTTTTTTTAGCTTATGCTTGTGCCGGGTCCGGGTATAACAACCATGAGT
AATCA
Protein Sequence
>WP_129935252.1 intimin [Escherichia coli]
MITHGFYARTRHKHKLKKTFIMLSAGLGLFFYVNQNSFANGENYFKLSSDSKLLTQNAAQDRLFYTLKTG
ETVANISKSQGISLSVIWSLNKHLYSSESEMMKAGPGQQIILPLKKLSVEYSALPVLGSAPVVAAGGVAG
HTNKMTKMSPDATKSNTTDDKALNYAAQQAASLGSQLQSRSLNGDYAKDTALGMASSQASSQLQAWLQHY
GTAEVNLQSGNNFDGSSLDFLLPFYDSENMLAFGQVGARYIDSRFTANLGAGQRFFLPENMLGYNVFIDQ
DFSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLMY
EQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKPWSQQIE
PQYVNELRTLSGSRYDLVQRNNNIILEYKKQDILSLNIPHDINGTEHSTQKIQLIVKSKYGLDRIVWDDS
ALRSQGGQIQHGGSQSAQDYQAILPAYVQGGSNIYKVTARAYDRNGNSSNNVQLTITVLPNGQVVDQVGV
TDFTADKTSAKADGIEAITYTATVKKNGVAQANVPVTFSIVSGTATLGANSARTDGNGKATVTLKSATLG
QVVVSAKTAEMTSPLNASAVIFVDQTKASITEIKADKTTAKADGSDAITYTVRVMKEGAPVVDQKVTFSK
DFGTLNKTEATTDQNGYATVKLSSNTPGKAIVSAKVSGVGTEVKATTVEFFAPLSIDGDKVTVIGTGITG
ALPKNWLQYGQVKLQATGGNGKYTWKSSNTKIASVDNSGVITLNEKGSATITVVSGDNQSATYTINAPGS
IVIAVDKNTRVTYFDAENKCKTNSANLAQSKELLANIYSTWGAANKYPYYSGSNSLTAWIKQSSSEQSSG
VSSTYDLVTKNQLINVGVNNKNAFSVCVK
Molecule Role Protective antigen
Molecule Role Annotation Systemic immunization of calves with a combination of EspA, intimin-531, and H7 flagellin resulted in a significant reduction in shedding of EHEC O157 to levels predicted to significantly impact on EHEC O157 cattle-to-cattle transmission (McNeilly et al., 2015)
Related Vaccines(s) E. coli O157:H7 intimin vaccine , E. coli vaccine using intimin polypeptide
References