VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Gag protein from SIV-mnd 2

Gene Name Gag protein from SIV-mnd 2
Sequence Strain (Species/Organism) Simian immunodeficiency virus SIV-mnd 2
VO ID VO_0010949
NCBI Gene ID 956108
NCBI Protein GI 27311167
Locus Tag Siv2gp1
Genbank Accession AF367411
Protein Accession NP_758886
Taxonomy ID 159122
Gene Starting Position 736
Gene Ending Position 2289
Gene Strand (Orientation) +
Protein Name gag protein
Protein pI 8.78
Protein Weight 55072.29
Protein Length 517
DNA Sequence
>NC_004455.1:736-2289 Simian immunodeficiency virus 2 isolate SIVmnd-2, complete genome
AATGGGCGCGAGCGCGTCAGGTCTTAGGGGAGAAAAATTGGACGAGCTGGAAAAGATTAGGTTACGGCCC
TCCGGAAAAAAGAAATACCAGCTGAAACACATAATATGGGTAAGCAAGGAACTAGACAGATTTGGCCTTC
ATGAAAAGCTGTTAGAAAGTAAGGAAGGATGCGAGAAAATTCTTAGCGTACTCTTTCCACTAGTTCCTAC
AGGGTCAGAAAATTTAATCTCGCTGTACAACACCTGCTGCTGCGTATGGTGCGTACATGCGAAAGAGAAA
GTAACAGATACAGAGGAAGCGAAAGAGAAAGTAAAACAAAAGCTCCATCTAGTGGCCGAAAAGGAAAATG
CAGCATCAGAAAAAGAACAAAGAGCAATAGTGACACCTAGTGGCCGCTCAAAAAATTACCCAATACAGAT
AATAAATCAGACCCCAGTCCATCAGGGAATTTCACCGCGCACGCTGAATGCGTGGGTAAAATGCATAGAA
GAGAAGAAGTTTAGCCCAGAAATAGTGCCCATGTTCATAGCCTTGTCTGAAGGGTGCCTCCCCTATGATC
TCAATGGCATGCTCAATGCTATTGGAGACCATCAGGGAGCGCTTCAAATAGTGAAGGATGTCATCAATGA
GGAAGCTGCAGACTGGAACTTGAGACACCCACAAGTGGGTCCTATGCCCCAAGGTGTCTTGAGAAACCCA
ACGGGCAGTGATATTGCTGGAACAACAAGCTCCATAGAAGAGCAGATAGAATGGACTACAAGGGAGCAAG
ATGCAGTAAATGTGGGAGGAATATATAAACAATGGATAGTTTTAGGGCTTCAGAAGTGTGTAAGCATGTA
TAATCCAGTAAACATCCTGGACATAAAGCAAGGACCAAAGGAGCCGTTCAAGGACTATGTGGACAGGTTT
TACAAAGCTCTGCGGGCGGAGCGGACTGATCCACAAGTCAAAACCTGGATGACACAAACTTTGCTCATCC
AGAATGCTAACCCAGATTGTAAATCCATCCTTAAAGGGCTAGGCATGAATCCCTCTTTAGAAGAGATGCC
GCTAGCCTGCCAAGGGGTAGGAGGCCCTAAATATAAAGCACAAATGATGGCAGAGGCTATGAAGGAAGCC
CAGTCAGCTGTAATGATGCAGAATTCGGGAGGGCCACCGCGGGGCCCCCCGAGACAACCTCCTAGAAACA
TCAGATGCCCTAACTGTGGAAAATTTGGTCATGGGCTGAGGGACTGTATAAGCCCTCGAAAAAAGGGATG
CTTCAAGTGTGGAGATCTAGGACACATAATGAGAAATTGCCCAAAGATGGTGAATTTTTTAGGGAATACC
CCCTGGGGCAGTGGCAAACCCAGGAACTTCCCGGCGATGCCATTGACCCCAACGGCCCCTCCAATGCCAG
GGATGGAAGACCCAGCAGAGAGAATGCTGTTAGATTACATGAAGAAAGGGCAACAGCAGAAAGCGGAAAG
CAAACAGGAAAAGAAAGAGAGGGGTCCATACGAGGCAGCTTACAACTCCCTCAGTTCTCTCTTTGGAACA
GACCAACTACAGTA

Protein Sequence
>NP_758886.1 gag protein [Simian immunodeficiency virus SIV-mnd 2]
MGASASGLRGEKLDELEKIRLRPSGKKKYQLKHIIWVSKELDRFGLHEKLLESKEGCEKILSVLFPLVPT
GSENLISLYNTCCCVWCVHAKEKVTDTEEAKEKVKQKLHLVAEKENAASEKEQRAIVTPSGRSKNYPIQI
INQTPVHQGISPRTLNAWVKCIEEKKFSPEIVPMFIALSEGCLPYDLNGMLNAIGDHQGALQIVKDVINE
EAADWNLRHPQVGPMPQGVLRNPTGSDIAGTTSSIEEQIEWTTREQDAVNVGGIYKQWIVLGLQKCVSMY
NPVNILDIKQGPKEPFKDYVDRFYKALRAERTDPQVKTWMTQTLLIQNANPDCKSILKGLGMNPSLEEMP
LACQGVGGPKYKAQMMAEAMKEAQSAVMMQNSGGPPRGPPRQPPRNIRCPNCGKFGHGLRDCISPRKKGC
FKCGDLGHIMRNCPKMVNFLGNTPWGSGKPRNFPAMPLTPTAPPMPGMEDPAERMLLDYMKKGQQQKAES
KQEKKERGPYEAAYNSLSSLFGTDQLQ

Molecule Role Protective antigen
Molecule Role Annotation A novel primate lentivirus was identified in Mandrillus sphinx. One of the newly isolated SIV strains was intravenously inoculated into two rhesus macaques and resulted in chronic infection. These SIVs do not cluster with SIVmndGB1, the former representative strain of SIVmnd, but form a new, independent lineage. These results indicate that these SIVmnds are a novel type of SIVmnd and have infected Cameroonian mandrills for a long time. To date, M. sphinx is the only primate species other than humans that is naturally infected with two different types of SIV (Takehisa et al., 2001).
Related Vaccines(s) Adenoviral vector Ad5 expressing SIV gag protein , DNA and poxvirus priming-boosting SHIV vaccine , HIV DNA and adenoviral vector Ad5 expressing SIV gag protein , HIV DNA vaccine Ad26/Ad5HVR48 encoding HIV or SIV env or gag , HIV DNA vaccine pHIS-SHIV-B , HIV DNA vaccine SIVmac239 Gag-Pol-Nef and mock Env with rAd5 boost
References