VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Trypanosoma cruzi

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. Myd88 (Other)
    2. amastigote surface protein-2 (Protective antigen)
    3. ASP-2 (Protective antigen)
    4. ASP-2 from strain Tulahuen (Protective antigen)
    5. ASP-2 from the Y strain (Protective antigen)
    6. ASP1 (Protective antigen)
    7. CRP-10 (Protective antigen)
    8. Cruzipain (Protective antigen)
    9. G2 (Protective antigen)
    10. Par1 (Protective antigen)
    11. protein G4 (Protective antigen)
    12. Tc00.1047053434931.10 (Protective antigen)
    13. Tc24 from Trypanosoma cruzi (Protective antigen)
    14. TS (Protective antigen)
    15. TS from strain Y (Protective antigen)
    16. TSA-1 (Protective antigen)
    17. TSA-1 (Protective antigen)
  3. Vaccine Information
    1. T. cruzi DNA vaccine encoding ASP-2
    2. T. cruzi DNA Vaccine encoding CRP-10 Protein
    3. T. cruzi DNA Vaccine encoding G2 Protein
    4. T. cruzi DNA Vaccine encoding G4 Protein
    5. T. cruzi DNA vaccine encoding TSA-1 and Tc24
    6. T. cruzi DNA Vaccine encoding TSA-1 protein
    7. T. cruzi DNA vaccine encoding TSA-1, ASP-1, ASP-2
    8. T. cruzi DNA Vaccine pGFP-TSA1
    9. T. cruzi DNA vaccine pTS encoding T. cruzi antigens
    10. T. cruzi DNA vaccine pUB-ASP-2
    11. T. cruzi PAR1 Protein Vaccine
    12. T. cruzi PAR2 Protein Vaccine
    13. T. cruzi vaccine using attenuated Salmonella expressing T. cruzi Cruzipain
    14. T. cruzi vaccine using Sendai virus vector expressing amastigote surface protein-2
  4. References
I. General Information
1. NCBI Taxonomy ID:
5693
2. Disease:
Chagas disease
3. Introduction
Chagas disease is a chronic, systemic, parasitic infection caused by the protozoan Trypanosoma cruzi, and was discovered in 1909. The disease affects about 8 million people in Latin America, of whom 30-40% either have or will develop cardiomyopathy, digestive megasyndromes, or both. In the past three decades, the control and management of Chagas disease has undergone several improvements. Large-scale vector control programmes and screening of blood donors have reduced disease incidence and prevalence. Although more effective trypanocidal drugs are needed, treatment with benznidazole (or nifurtimox) is reasonably safe and effective, and is now recommended for a widened range of patients. Improved models for risk stratification are available, and certain guided treatments could halt or reverse disease progression (Rassi et al., 2010).
4. Microbial Pathogenesis
Organ and tissue damage during acute T cruzi infection is caused by the parasite itself and by the host's acute immunoinflammatory response, which is elicited by the presence of the parasite. Findings from several studies in experimental models of T cruzi infection have suggested that a strong T-helper-1 immune response with both CD4 and CD8 cells, and characterised by the production of some specific cytokines—such as interferon γ, tumour necrosis factor α, and interleukin 12—is important in the control of parasitism. By comparison, production of interleukin 10 and transforming growth factor β is related to parasite replication by inhibition of macrophage trypanocidal activity. The T-helper-1 immune response has a protective role mainly through the synthesis of nitric oxide, which exerts a potent trypanocidal action. During chronic infection, the balance between immune-mediated parasite containment and damaging inflammation of the host tissues probably determines the course of disease. If the immunological response is inefficient, or paradoxically leads to tissue damage, both parasite load and immune-mediated inflammation increase. By contrast, a well executed immune response, in which parasite burden is lowered and inflammatory consequences are kept to a minimum, results in reduced tissue damage (Rassi et al., 2010).
5. Host Ranges and Animal Models
Chagas disease is transmitted to human beings and to more than 150 species of domestic animals (eg, dogs, cats, and guineapigs) and wild mammals (eg, rodents, marsupials, and armadillos) mainly by large, blood-sucking reduviid bugs of the subfamily Triatominae, within three overlapping cycles: domestic, peridomestic, and sylvatic. Although more than 130 species of triatomine bugs have been identified, only a handful are competent vectors for T cruzi. Triatoma infestans, Rhodnius prolixus, and Triatoma dimidiata are the three most important vector species in the transmission of T cruzi to man (Rassi et al., 2010).
1. amastigote surface protein-2
  • Gene Name : amastigote surface protein-2
  • VO ID : VO_0011289
  • NCBI Protein GI : 284180153
  • Other Database IDs : CDD:140355
    CDD:29333
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : amastigote surface protein-2
  • Protein Length : 703
  • Protein Note : ASP-2
  • Protein Sequence : Show Sequence
    >gi|284180153|gb|ADB82626.1| amastigote surface protein-2 [Trypanosoma cruzi]
    MLSRVAAVKAPRTHNRHRVTGSSGRRREGRESEPQRPDMSWRAFTSAVLLLLLVIICCGSGAADAVEGKS
    GAVQLPKWVDIFVPEKTHVLPKEGSESGVKKAFAAPSLVSAGGVMVAFAEGLFGHNVHGYDLFGIRPYEI
    LAGYIKAAESWPSIVAEVNASTWRAHTVIGSRNGNDRLCFLYRPTAVARENKVFLLVGSDTVGYDSDDDM
    WVKDGWDIQLVEGVATQSTDGKPSKTINWGEPKSLLKQVPKHTQDQLRDVVTAGGSGIVMQNNTFVFPLV
    VNGKNYPFSSITYSTDNGNNWVFPESISPVGCLDPRITEWETGQILMIVDCGNGQSVYESRDMGKTWTEA
    IGTLSGVWVKSRSGFRWDEGLRVDALITATIEGRKVMLYTQRGCASGEKEANALYLWVTDNNRTFHVGPV
    AMDSAVNETLSNALLYSDGNLHLLKQRANEKGSALSLARLTEELKEIDSVLSTWARLDASFSASSTPTAG
    LVGFLSNTSSGGDTWNDEYRCVDASVTKASKVKNGIKFTGPGSMATWLVNSREDNRQYGFVNHSFTLVAT
    VTIHQVAKGSTPLLGAGLDAPVSTNFIGLSYSMDKRWETVFYGKKTTSNTTWELGKEYQVALMLQDGNKG
    SVYVDGVIVGSPENITKLGALGHEIAHFYFGGDEGYINSSVTVTNVFLYNRPLSVGELKMVRKSDDKKGN
    GGD
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : To examine the efficacy of a new mode of recombinant viral vaccine, a vaccine was constructed of two non-transmissible Sendai viruses (rSeV/dF) encoding the full-length parasite antigen amastigote surface protein-2 (ASP2) or ASP2 fused with a mono-ubiquitin on its N-terminus (UASP2). C57BL/6 mice immunized intranasally with rSeV/dF expressing either ASP2 or UASP2 showed significantly suppressed parasitemia and could be protected from lethal T. cruzi challenge (Duan et al., 2009).
  • Related Vaccine(s): T. cruzi DNA vaccine encoding ASP-2 , T. cruzi DNA vaccine encoding TSA-1, ASP-1, ASP-2 , T. cruzi DNA vaccine pUB-ASP-2 , T. cruzi vaccine using Sendai virus vector expressing amastigote surface protein-2
2. ASP-2
  • Gene Name : ASP-2
  • Sequence Strain (Species/Organism) : Trypanosoma cruzi strain Brazil
  • NCBI Nucleotide GI : 1684906
  • NCBI Protein GI : 1684907
  • Protein Accession : AAC47720.1
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : amastigote surface protein-2
  • Protein Note : sialidase-like protein
  • DNA Sequence : Show Sequence
    >gi|1684906|gb|U77951.1|TCU77951 Trypanosoma cruzi amastigote surface protein-2 (ASP-2) mRNA, partial cds
    CAGTTTCTGTCCTATATTGAAAGAAAATAAACGCTAAGGGCTAATCACTACTGAGAAATTCGAAGGCTCT
    GAAAGGACCAACAGCACACACATTGCCCACCCACACATATTTGTATGCTCTCACGTGTTGCTGCTGTCAA
    GGCACCCCGCACACACAACCGTCGCCGCGTGACCGGATCCAGCGGAAGGAGGAGGGAAGGACGAGAGAGT
    GAGCCGCAGAGGCCCAACATGTCCCGGCGTGTGTTTACTTCCGCGGTGCTGCTCCTCCTCCTCGTGATTA
    TTTGCTGCGGCCCCTGTGAGGCTGCAGACGCTGTGGAGGGTAAGTCCGGGGCCGTGCAACTACCGAAATG
    GGTCGATATTTTTGTGCCGGAAAAGACGCATGTGCTGCCCAAAGAGGGGTCTGAAAGTGGAGTGAAGAAA
    GCATTTGCTGCGCCTTCTCTTGTCAGTGCTGGTGGAGTAATGGTTGCCTTTGCTGAAGGCTTTTCCGAGT
    ATAACGCCCATGAAAATAACCCGTTTGGGATTCGGCCTTACGAAATTTTGGCCGGGTACATCAAGGCTGC
    GGAGTCGTGGCCGTCCATTGTCGCTGAGGTCAATGCTAGTACATGGAGGGCACACACCGTTATTGGCAGT
    AGGAATGGCAATGATCGTTTGTGTTTTTTGTACCGGCCCACAGCAGTTGCAAGGGAAAATAAGGTGTTTT
    TGCTTGTGGGAAGCGATACCGTAGGATATGACAGCGATGATGATATGTGGGTAAAAGATGGCTGGGACAT
    TCAACTAGTTGAGGGTGTGGCCACGCAGTCCACGGACGGCAAGCCGAGTAAAACGATCAACTGGGGTGAA
    CCCAAGTCGCTTTTAAAGCATATCCCCAAACACACTCAAGGTCACCTGAGGGATGTTGTGACTGCTGGTG
    GTTCAGGCATTGTGATGCAGAATAACACGCTTGTGTTTCCCCTGGTGGTGAATGGGAAAAATTACCCTTT
    TTCTTCGATCACTTATTCGACGGACAACGGCAACAACTGGGTGTTCCCAGAGAGCATTTCTCCTGTAGGA
    TGCCTTGATCCCCGCATCACCGAATGGGAGACGGGACAAATTCTCATGATTGTTGATTGCGGGAATGGCC
    AGAGTGTGTATGAGTCGCGTGACATGGGGACAACGTGGACGAAGGCTGTCAGAACACTCTCAGGCGTGTG
    GGCCATTTCACAACGAGGAGTTCGTTCATACGAAATTTTTCGTGTGGGAGCCATCATCACCGCGACCATT
    GAGGGAAGGAAGGTCATGCTGTACACTCGGAGAGGGTACGCCTCGGGGGAGAAAGAGGCCAATGCCCTCT
    ACCTTTGGGTCACGGACAACAACCGTACGTTTCATGTTGGTCCCGTTGCCATGGACAGCGCTGTGAATGA
    GACGCTTTCCAACGCCCTGCTGTACTCGGATGGCAATTTGCATCTTTTACAACAGAGGGCCAATGAAAAA
    GGCAGTGCCATTTCACTTGCCCGCCTGACGGAGGAACTGAAGGAAATCGAGTCTGTCCTGAGGACTTGGG
    CACAGCTTGACGCCTTCTTCTCCAAGTCGTCCACACCCACGGCTGGCCTGGTTGGATTTCTGTCCAATAC
    ATCGTCCGGTGGTAACACGTGGATTGACGAGTACCGTTGCGTGAATGCAACGGTGACGAAAGCATCAAAA
    GTCAAAAATGGTTTCAAATTCACGGGGCCTGGACCCATGGCAACATGGCTCGTGAACAGCCGGGAGGATA
    ACAGACAGTACAGCTTTGTGAACCACAGATTCACCCTTGTGGCGACGGTGACCATCCACCAGGTTCCGAA
    GGGGAGCACTCCTCTGCTGGGTGCGGGTCTGGGGGACGGTCACGGCGCGAAGATCATTGGGCTGTCGTAC
    AGCATGAATAAAACGTGGGAGACGGTGTTTTATGGGAAGAAAACGACATCGAACACCACTTGGGAGCTGG
    GGAAAGAATACCAGGTGACGCTCATGCTGCAGGACGGCAACAAGGGCTCCGTGTACGTGGATGGTGTGAT
    TGTGGGGAGCCCAGCGAAGATACCGAAAGTTGGGGCGCTGGGACATGAAATCGCACATTTCTATTTTGGT
    GGGGGTGAGGGAGACAGCGACAGCAGCGTGACAGTGACGAACGTCTTTCTGTACAACCGCCCACTGAGTG
    TCGGTGAACTAAAAATGGTCAGGAAGAGCGACGATAAAAAAGGAAACGGTGGCGACCAAAAA
  • Molecule Role : Protective antigen
3. ASP-2 from strain Tulahuen
  • Gene Name : ASP-2 from strain Tulahuen
  • Sequence Strain (Species/Organism) : Trypanosoma cruzi strain Tulahuen
  • NCBI Nucleotide GI : 284180152
  • NCBI Protein GI : 284180153
  • Protein Accession : ADB82626.1
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : amastigote surface protein-2
  • Protein Note : ASP-2
  • DNA Sequence : Show Sequence
    >gi|284180152|gb|GU445326.1| Trypanosoma cruzi strain Tulahuen amastigote surface protein-2 mRNA, partial cds
    ATGCTCTCACGTGTTGCTGCTGTCAAGGCACCCCGCACACACAACCGTCACCGCGTGACCGGATCCAGCG
    GAAGGAGGAGGGAAGGAAGAGAGAGTGAGCCGCAGAGGCCCGACATGTCCTGGCGTGCGTTTACTTCCGC
    GGTGCTGCTCCTCCTCCTCGTGATTATTTGCTGCGGCAGTGGAGCTGCAGACGCTGTGGAGGGTAAGTCC
    GGGGCCGTGCAACTACCGAAATGGGTCGATATTTTTGTGCCGGAAAAGACGCATGTGCTGCCCAAAGAGG
    GGTCTGAAAGTGGAGTGAAGAAAGCATTTGCTGCGCCTTCTCTTGTCAGTGCTGGTGGAGTAATGGTTGC
    CTTTGCTGAAGGCTTGTTCGGTCATAACGTCCATGGATATGACTTGTTTGGGATTCGGCCTTACGAAATT
    TTGGCCGGGTACATCAAGGCTGCGGAGTCGTGGCCGTCCATTGTTGCTGAGGTCAATGCTAGTACATGGA
    GGGCACACACAGTTATTGGCAGTAGGAATGGCAATGATCGTTTGTGTTTTTTGTACCGGCCCACAGCAGT
    TGCAAGGGAAAATAAGGTGTTTTTGCTTGTGGGAAGCGATACCGTAGGATATGACAGCGATGATGATATG
    TGGGTAAAAGATGGCTGGGACATTCAACTAGTTGAGGGTGTGGCCACGCAGTCCACGGACGGCAAACCGA
    GTAAAACGATCAACTGGGGTGAACCCAAGTCGCTTTTAAAGCAGGTCCCCAAACACACTCAAGATCAGCT
    GAGGGATGTTGTGACTGCTGGTGGTTCAGGCATTGTGATGCAGAATAACACGTTTGTGTTTCCCCTGGTG
    GTGAATGGGAAAAATTACCCTTTTTCTTCGATCACTTATTCGACGGACAACGGCAACAACTGGGTGTTCC
    CAGAGAGCATTTCTCCTGTAGGATGCCTTGATCCCCGCATCACCGAATGGGAGACGGGACAAATTCTCAT
    GATTGTTGATTGCGGGAATGGCCAGAGTGTGTATGAGTCGCGTGACATGGGGAAAACGTGGACGGAGGCC
    ATCGGGACACTCTCGGGCGTGTGGGTCAAGTCACGATCAGGATTCCGTTGGGACGAAGGCTTGCGTGTGG
    ATGCCCTCATCACCGCGACCATTGAGGGAAGGAAGGTCATGCTGTACACTCAGAGAGGGTGCGCCTCGGG
    GGAGAAAGAGGCCAATGCCCTCTACCTTTGGGTCACGGACAACAACCGTACGTTTCATGTTGGTCCCGTT
    GCCATGGACAGCGCTGTGAATGAGACGCTTTCCAACGCCCTGCTGTACTCGGATGGCAATTTGCATCTTT
    TAAAACAGAGGGCCAATGAAAAAGGCAGTGCCCTTTCACTTGCCCGCCTGACGGAGGAACTGAAGGAAAT
    CGATTCTGTCCTCAGCACTTGGGCACGGCTTGACGCCTCCTTTTCCGCTTCGTCCACACCCACGGCTGGT
    CTGGTTGGATTTCTGTCCAATACATCGTCCGGTGGCGACACGTGGAACGACGAGTACCGTTGCGTGGATG
    CATCCGTGACGAAAGCATCAAAGGTTAAAAATGGTATCAAATTCACGGGGCCTGGATCCATGGCAACATG
    GCTCGTGAACAGCCGGGAGGATAACAGACAGTACGGCTTTGTGAACCACAGCTTCACTCTTGTGGCGACG
    GTGACCATCCACCAGGTTGCGAAGGGGAGCACTCCTCTGCTGGGGGCGGGTCTGGATGCACCCGTCAGCA
    CGAACTTCATTGGGCTGTCGTACAGCATGGATAAAAGGTGGGAGACGGTGTTTTATGGGAAGAAAACGAC
    ATCGAACACCACTTGGGAGCTGGGGAAAGAATACCAGGTGGCGCTCATGCTACAGGACGGCAATAAGGGC
    TCCGTGTACGTGGATGGTGTAATTGTGGGGAGCCCAGAGAATATAACAAAGCTTGGGGCGCTGGGACATG
    AAATCGCACATTTCTATTTTGGTGGGGACGAGGGATACATCAACAGCAGCGTGACAGTGACGAACGTCTT
    TCTGTACAACCGCCCACTGAGTGTCGGCGAACTAAAAATGGTCAGGAAGAGCGACGATAAAAAAGGAAAC
    GGTGGCGAC
  • Molecule Role : Protective antigen
4. ASP-2 from the Y strain
  • Gene Name : ASP-2 from the Y strain
  • Sequence Strain (Species/Organism) : Trypanosoma cruzi strain Y
  • NCBI Protein GI : 30313709
  • Other Database IDs : CDD:185561
    CDD:29333
    CDD:205563
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : surface protein-2
  • Protein Length : 694
  • Protein Note : trans-sialidase; Provisional
  • Protein Sequence : Show Sequence
    >gi|30313709|gb|AAO84044.1| surface protein-2 [Trypanosoma cruzi]
    MLSRVAAVKAPNTHNRHGVTGSSGRRREGRESEPKRPNMSRHLFTSAMLLLLVVIMTCCATCGAAAAVES
    KSGDAPLPQWVDIFVPEKTQVLPKEGSKSGVKKAFAAPSLVSAGGVMVAFAESLFVYIVHEHNLFGIKPY
    EIVAGYIKAAESWPSIVAEVNATTWRTHTVIGSRNGNDRLCYLQRPTAVARDSKVFLLVGSDTTRYDSDD
    NMWVKDGWDIQLVEGVATQSKDGVQSKLVSWGEPKSLLKQILNHTQDQLRDVVTAGGSGIVMQNDTLVFP
    LMVNGQNYPFSSITYSTDKGNTWVFPEGISPVGCLDPRITEWETGQILMIVQCKDDQSVFESRDMGKTWT
    EAIGTLSGVWVMSQPGVRLYKIFRVGALITATIEGRKVMLYTQRGYTSGEKEATALYLWVTDNNRTFHVG
    PLFLEDNVNETLANALLYSDGALHLLKERANEKDEAISLARLTEELNTIKSVLSTWAKLDASFSESSTPT
    AGLVGFLSNTSSGGDTWIDDYRCVHASVTKASKVKNGFKFMGPGSMATWPVNSREDNRQYSFVNHRFTLV
    ATVTIHQVAKGSTPLLGAGLGDGHGAKIIGLSHSMNKTWETVFDGKKMTSNTTWELGREHQVALMLQDGH
    KGYVYVDGVIVGSPENIRTPETLGHEITHFYFGGGEGDINSSDVTVTNVFLYNRPLSVGELKMV
  • Molecule Role : Protective antigen
5. ASP1
  • Gene Name : ASP1
  • Sequence Strain (Species/Organism) : Trypanosoma cruzi strain Sylvio X-10/4
  • NCBI Nucleotide GI : 1658194
  • NCBI Protein GI : 1658195
  • Protein Accession : AAB18265.1
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : surface protein-1
  • Protein Note : surface protein
  • DNA Sequence : Show Sequence
    >gi|1658194|gb|U74494.1|TCU74494 Trypanosoma cruzi surface protein-1 mRNA, complete cds
    GGCACGAGCGGATCCAGCGGAAGGAGGAGGGAAGGAAGAGAGAGTGAGCCGCAGAGGTTCAACATGTCCC
    GACATCACTTCTATTCCGCGGTGCTGCTTCTTGTCGTGATGATGTGCTGTGGATTTGGAGCTGCACACGC
    TGTGGAAAGTAATTTGAGGGATGCGCAGATGCCGCAATGGGTTGATATTTTTGTCTCGGGTAAGACGCGG
    GTGCTGGCAAAGGATGGGACTGAAGTCGGAGCGAGCGATTCGTTTGGCGCAGGCTCTCCTGTCATTGCTG
    GCGGAGTGATGGCTGTGGTTACTACCGGCAATTTTTTACGTGATCCTGTAATATTCCTTTCTCAATCTGA
    TGTTGTTGGGGGGTATTTCAACCCTGCGTGGGATTGGTCGTTCCTTGTCGCTAAGGTCAGTGAGGATACA
    TGGAGAGCACACACTGTGTTTCATACAGCGAATGAAACGGAACTTGTGGGTGTTGCGCGCCTTCCGACAA
    CCATTGGGAAGGGCAATAAGGTGTATCTCCTTGTGGAAAGCTATGAAAAGAAGTATGACGGCGCCGCGAA
    GAAATGGACGACGGATGGCAAGGATATCAAACTGATTGTGGGTGACGCCAGGCCGTCCACGGGCAGAAGG
    GAGAGTGGAACAATCATCTGGGGCGATCCCACATCGCTGTTACAACAGCTCACCCCAGAGACTCAAACTG
    AGTTGAAGAAGCTTGCTCCCTTTGGTGGCGCTGGTGTTCTGATGGAGAATGGCACTCTCGTGTTTCCTTT
    GTCGGGGACTAATGAACAGCGTGGGCATTCCAACAGGATCACTTACTCGACGGACGACGGCACAAACTGG
    GTGTTTCCGGCGGGTACGCCCCCTGCGGAATGTGTTGGAATCAGCATCACCGAATGGGAGACGGGACAAA
    TTCTCATGGTTACTGGATGCACGATTGGTCGCAAGGTGTACGAGTCGCGTGACATGGGGACAACGTGGAC
    GGAGGCTGTCGGGACACTCCCAGGCGTGTGGGTCAACGCACGATCAGGAACTCGTTGGACTGTTGATTTG
    TCTGTGGGATCTCTCATCACCGCGACCATTGAGGGAGTGAAGGTCATGCTGTACACTCATAAAAGATACC
    GCACTTTGGGAGAAAAAGGAGAAGGCGCTCTATCTTTGTGTCACGGACAACAGCCGCATGTTTTGGGCTT
    GGACCGATTTATGTGGAGAGTCTTTTGGAGTGAGACAGTTTCCAACAACCTGCTGCACTCGGATGGTGCG
    TTGCACATTACAAGATTAACGTATACAGGAGCCGGCACAGTCATTTCACTTGCCCGGCTAACAAGGGAAC
    TGGAGACAATCAAGTCCACCCTCAGTAATTGGAAAAAGCTGGACGCCTCCTTCTCCAAGTCGTCCACACC
    CACAGCCGGTCTGGTTGGATTTTTGTCCAACGCGGCCAGTGATGACACGTGGCTTGACGATTACGGCTGC
    GTGAATGCAAACGTGACGAGAGCAACGAAGGTTCACAACGGTTTTAAATTTATGGGGGCTGGATCCAAGG
    CAGTGTGGCCCGTGAACACCTGGGAGGAAAATACTTACTACGGCTTTGTGAACCACGATTTCACTGTTGT
    GGCGACGGTGGTCATCCACAAGGCTCCGAGTGAGAGCACTCCTCTGCTGGGTGCGGGTCTGGGAGACAAT
    GACGGCACTAAGTTTATTGGGCTGTCGTACGATGCGAACCGTAATTGGGAGACAGTGTTCAGCGCCAAAA
    AAACAGCATCGGGCAGCACTTGGGAGCCGGGGAAAGAATACCAAGTGGCGCTCATGCTGCAGGGCGCCAA
    CAAGGGCTCAGTGTACGTGGATGCCAAGCTCGTGGGGAGCCCGGAGACGTTACCAACACCTGAGACGCGG
    GGGGCTGAAATCACACATTTCTACATTGGGGGAGACGAGGGAGACAGCGGAAGCGATCTGACGGTGACGA
    ATTCCTTTCTGTACAACCGCCCACTGAGTGAAGATGAACTAAAAATGGTCAAGAAGAAAGAGGACTCCGT
    GCGTGGAGACGTGTCTCGGGTGCTCCCGCTGCTTCTGCTGGGGCTGTGGGGCCTTACGGGCCTTTACTGA
  • Molecule Role : Protective antigen
  • Related Vaccine(s): T. cruzi DNA vaccine encoding TSA-1, ASP-1, ASP-2
6. CRP-10
  • Gene Name : CRP-10
  • VO ID : VO_0011297
  • NCBI Protein GI : 1389837
  • Other Database IDs : CDD:29333
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : complement regulatory protein
  • Protein Length : 1003
  • Protein Note : Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates as well as playing roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold...; cd00260
  • Protein Sequence : Show Sequence
    >gi|1389837|gb|AAB49414.1| complement regulatory protein [Trypanosoma cruzi]
    MSRHVFASAVLLLVVVMTSCSSEATYGKEGNSRNGIIFEGGDSFSDPETENLLQAFDSFRAPSLAYVNGV
    VVATVEAHYTNSTDNKSCVSLAARSMESSGGEWTNGTAIVFDHYDVKIDRLLSPTTFVDERDGATNALVG
    GYGTSTTPLTEVTGDGKYWAPRIAAGSLIPYDDEEKKEFKWNQVASTSGVPHDLWESERTNPKRFKQFLG
    GGGACIKMEDDGRYVLPIQALKDDGKVVSLVILAKKTSYGWEFSNGTSDEGCIQPAVLEWKEKELIMMTS
    CDDGSRRVYRSSTMGNLWTEEYDTLSRVWGNSRTRVGHGAQGGFVSAMIDGQKVILVSRPVYSEKDKKET
    GRLHLWLTDMQRIYDVGPISAVGENVAASTLLYATVEAQPLKEEEPKEEKKLYCPYEVAAEDGKYNIAFV
    GLTEKLEDMRKVLAAWKEKDAQIAKEYRCGNEKNNWRSGCDARELTKGLVGLLSNKSTKNTWSDEYLCVN
    ATVHGEVESAPDGGLTFKGPGAGAKWPVGDMGQTVPYHFANDKFTLVATVSIDKAPETGSSPIPLMGVRM
    NDAQGTVLFGLSYTHDKEWRIIFNGSRLPLPAHYENVEWEANKKYHLALQMDCDDGLFVYVNGKRICDTE
    DYEDEDYEGYKSFSHKLRKLLSSHSISHFYIGGDGKSSSGNIHVTVSNALLYNRLLQDDELNPLMKTKAV
    AASEAEVSAPEGAPQNSHLGQASEKDTTPSTQNQGLSPEKSKNEKYSAGSGQTTSADFTGSSTSAAEGEV
    EEVASSSVGSASSLTPTAGEGSPQKAPETDFPATEDHFEREQEHSSLSVVRPMTEQAEEAVVATPQRKTT
    EDRPQHSTLSDASEDMEESSSHSATLTSDEQTVEPEERKDTNPHTAVGASSGPDSSHSTEVAPMDGATAA
    HEPSTDPATAQGHDEVLDGGDAAKDYLRTTPGETKIPSESNATIPLDPVILLEHGHLSDLASMALIGDST
    VHGCVSRVLLLLLLGLWGTAVLC
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A complement regulatory protein (CRP) of Trypanosoma cruzi was evaluated as a vaccine candidate in a murine model of experimental T. cruzi infection. Recombinant CRP derived from an Escherichia coli expression system and a plasmid encoding the full-length crp structural gene under the control of a eukaryotic promoter were used to immunize BALB/c mice. Immunization with both protein and DNA vaccines resulted in a Th1-type T-cell response, comparable antibody titers, and similar immunoglobulin G isotype profiles. Only mice immunized with the crp DNA plasmid produced antibodies capable of lysing the parasites in the presence of complement and were protected against a lethal challenge with T. cruzi trypomastigotes (Sepulveda et al., 2000).
  • Related Vaccine(s): T. cruzi DNA Vaccine encoding CRP-10 Protein
7. Cruzipain
  • Gene Name : Cruzipain
  • Sequence Strain (Species/Organism) : Trypanosoma cruzi
  • VO ID : VO_0011293
  • NCBI Protein GI : 1136308
  • Other Database IDs : CDD:157580
    CDD:30292
    CDD:152566
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : cruzipain
  • Protein Length : 467
  • Protein Note : internal copy from a tandem array
  • Protein Sequence : Show Sequence
    >gi|1136308|gb|AAB41119.1| cruzipain [Trypanosoma cruzi]
    MSGWARALSLAAVLVVMACLVPAATASLHAEETLASQFAEFKQKHGRVYGSAAEEAFRLSVFRENLFLAR
    LHAAANPHATFGVTAFSDLTREEFRSRYHNGAAHFAAAQERARVPVNVEVVGAPAAVDWRARGAVTAVKD
    QGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCGGGLMNNAFEWIVQENNGAVYTEDS
    YPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSE
    QLDHGVLLVGYNDSAAVPYWVIKNSWTTQWGEDGYIRIAKGSNQCLVKEEASSAVVGGPGPTPEPTTTTT
    TSAPGPSPSYFVQMSCTDAACIVGCENVTLPTGQCLLTTSGVSAIVTCGAETLTEEVFLTSTHCSGPSVR
    SSVPLNKCNRLLRGSVEFFCGSSSSGRLADVDRQRRYQPYHSRHRRL
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : To study the protective effects in vivo of cruzipain-specific Th1 responses against systemic T. cruzi challenges, mice were immunized with recombinant cruzipain plus interleukin 12 (IL-12) and a neutralizing anti-IL-4 MAb. These immunized mice developed potent cruzipain-specific memory Th1 cell responses and were significantly protected against normally lethal systemic T. cruzi challenges. To study whether cruzipain could induce mucosal immune responses relevant for vaccine development, recombinant attenuated Salmonella enterica serovar Typhimurium vaccines expressing cruzipain were prepared. BALB/c mice immunized with salmonella expressing cruzipain were significantly protected against T. cruzi mucosal infection (Schnapp et al., 2002).
  • Related Vaccine(s): T. cruzi vaccine using attenuated Salmonella expressing T. cruzi Cruzipain
8. G2
  • Gene Name : G2
  • Sequence Strain (Species/Organism) : Trypanosoma cruzi
  • VO ID : VO_0011299
  • NCBI Protein GI : 205278890
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : protein G2
  • Protein Length : 218
  • Protein Sequence : Show Sequence
    >gi|205278890|gb|ACI02320.1| protein G2 [Trypanosoma cruzi]
    MSLSFIESGFVPSDGMCRGVEAADTSAAAELLHLAVPPLMEAGGKTRVCVAFYEAAQCPFDSRCEHAHHF
    SELNGYTQNKLLETVPVESIPKHFMAPRNSNSSSGNNKNDRTFYATDGNAANYTATAAVDGGVAHRSLGG
    GHGEKEKTSSNRRSKRTARLYDISGSNANLCDNSLSSLASSTDTLLLLGSVHDSKDVSPQKGTRRDEGME
    AFRIRLPP
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The vaccine efficacy of a putative candidate antigen against T. cruzi infection and disease in a mouse model. C57BL/6 mice vaccinated with a T. cruzi G2-encoding plasmid and cytokine (interleukin-12 and granulocyte-macrophage colony-stimulating factor) expression plasmids elicited a strong Th1-type antibody response dominated by immunoglobulin G2b (IgG2b)/IgG1 isotypes. The dominant IgG2b/IgG1 antibody response was maintained after a challenge infection and was associated with 50% control of the acute-phase tissue parasite burden and an almost undetectable level of tissue parasites during the chronic phase, as determined by a sensitive T. cruzi 18S rRNA gene-specific real-time PCR approach (Bhatia and Garg, 2008).
  • Related Vaccine(s): T. cruzi DNA Vaccine encoding G2 Protein
9. Myd88
  • Gene Name : Myd88
  • Sequence Strain (Species/Organism) : Mus musculus
  • NCBI Gene ID : 17874
  • NCBI Protein GI : 6754772
  • Genbank Accession : AAHY01082338
  • Protein Accession : NP_034981
  • Taxonomy ID : 10090
  • Chromosome No : 9
  • Gene Starting Position : 119335987
  • Gene Ending Position : 119340039
  • Gene Strand (Orientation) : -
  • Protein Name : myeloid differentiation primary response gene 88
  • Protein pI : 5.13
  • Protein Weight : 31966.34
  • Protein Length : 296
  • Protein Note : Also known as A1B; ABG; GAB; HYST2477
  • DNA Sequence : Show Sequence
    >gi|372099101:119335987-119340039 Mus musculus strain C57BL/6J chromosome 9, GRCm38.p3 C57BL/6J
    AAAGTACAAACACGAGCCCTTCTTTTCTTTATTGACATTCCCATGAAACCTCTAACACAGGTGGAGGAGG
    TTTACACTTGACCCAGGTTGCTTTAAAATGCTCAACATCAAGCAGTGAAATGCCCCATGAGACCGTGCAC
    AGAGGCCTCATTCCTCCCCCAGACACTGAGGGGAGACTCACTTTCTTGGGGACTCAGGGCCCTGGGGTGT
    ACCCTGAGAGGGACCATGACATTGCCTCTATGGTAGAGAACGTGAAAGGAATAAGAAGATGCAAACCTCG
    CTGCTGGGGAGAAAACAGCTGAGCCTGCAGCTGCTTTGTGGGGCGAAGCCAAACAGCTTCTCCTTTTTAT
    CTTCAGCTTACTAAGGGCCCAAATGCTATCATGTTTGGGGCCTTCCTAGACTTTGCTTTCAACAGGTAGA
    GAAAAGAGAGGAGAAATCCACAGTGCCCCCAGATTTTCCTTCTTTTCTGGGGGTAGGGGATGGGGGAGGT
    AGGCTCTCATGTAGCCCAGGCTGACCTTAAACTAGGTGTGTTGCCAAGGATAAGCTTGAACTCCTGATTC
    TCCTGCCTCTACCTCCCAAATGCTGAAACTATAGGCCCGTGCCACTACCTGTAGCAAAGGCACCCCACTT
    TTGTCCAGGGAGATGGCCAGGCCCCCTTGATGATAGAACTCTTCCACTCAGCTATCCTTGGGAGCTGTCC
    CAAAGGAAACACACATATGCAGATGCCTGTGTGTGCGAGGAGGCATGTGTGTACTGAGGTGCGTGCACAG
    GCATGGGTGGCTGGGAGGAAAGGCAGTCCTAGTTGCTCAGGCCAGTCATCATTGAACACGGGTTGAGCCC
    AGGGGAGTCAAAGATGTAGACAGGACGGCATCAGAGAATCTGGCTCCGCATCAGTCTCATCTTCCCCTCT
    GCCCTGTGGGAGGAAGAAAGGGAGTTTAAGGTTGGCAGGTCAAAGCAGCTGTCCTGGCAAGCCTGTGGTG
    CTCCTTAACAGCCAGTGTGTGCTCCTTCAGCTCCCCTTCAGCCCACACTGGGTCTCCTAGGATAGCCAGA
    AGAGTGCCTCACTATTTCCCTGCCTGATCTCCATATCCTGTTTCTCAGGAGGAGACCCTGAGGCCAAAGA
    TGTCTGAGATGTAGCTCAACTAGTCCTTCGCTTAGACTCATGCAGCCCTGATAAACACTGTCCTGGCTGG
    CAACCCGGCAAGTCATAATGTCACTTGCAGTCACTGGTTCCGTAAGGACTTGAGAGATGACATCTGGCTA
    CTGTAGATGTCTAGGGATAGACGGACCACAAGCTCCCCACTACAGTGTCAAAGGAGGCAAGCGGAAGAAC
    ACAGACAGACTGACATACCTAGGGCTCCCAGGGTCATCTTCAGGGCAGGGACAAAGCCTTGGCAAGGCGG
    GTCCAGAACCAGGACTTGGTGCAAGGGTTGGTATAGTCGCATATAGTGATGAACCGCAGGATACTGGGAA
    AGTCCTTCTTCATCGCCTTGTATTTAATAGGAATCAGTCGCTTCTGTTGGACACCTGAAGGCCAAAGGGT
    GTGGTATTAGGACCACGTGGGGCCCTAGGGTGGGACAGGCTCAGTCCCTAAAGCACGGGCTAACACCAGC
    TCTCCACCAACCAGGTATCCATGATACATATCCACTACATAAGGAAGTACACAGGTCCGTCCTCAGAGAT
    CTGTAGTGCTTTGGTTTTGCATTCCTGGACTATCATCCTAAGGCTATATCTCTACTCTCTCTTTGACCAA
    AGCAGGCCTAAGCTTACCTGGAGACAGGCTGAGTGCAAACTTGGTCTGGAAGTCACATTCCTTGCTCTGT
    AGATAATCGTCAGAAACAACCACCACCATGCGGCGACACCTGAGGGAGAGTGGCACTGCGGTGACTTCCT
    TCAGAGGATGGGGTCAGGAAGGACTACATTACCCAGGCGGGACAGAGCCCAGCTAGCAGGACAGTCCTTG
    CATCTGGACCTCTGGGTTTCATGCATTCACCCACCTACCCTCTTAGATGTTTAACCAACCTTTTCTCAAT
    TAGCTCGCTGGCAATGGACCAGACACAGGTGCCCGGCAGGACGTCACGGTCGGACACACACAACTTAAGC
    CGATAGTCTGTCTGTTCTAGTTGCCGGATCATCTCCTGCACAAACTCGATATCGTTGGGGCAGTAGCAGA
    TAAAGGCATCGAAAAGTTCCGGCGTTTGTCCTGAGGACAGGGGACAAGGGAATCAATCAGCCTCTGCAGA
    AGGCTGGAAGGAGCCCAACCTGGAGTCTTCCATCAAGGGAACCTGGGCCTGTATCCATATCAAAGCAATG
    TCATATACATGCCCTCTCTACCAGTGAACAGATAACTTCCTCCCAGATGAAATCCCGGTTAACTATGATG
    GAGGCATGCCATTAAAGTCTCAGAACCACTCTGGGAGAGGACTGCCATTATTCCCATTTCTTAGATGGGG
    AAACCAAGGCTCAGAATGAGCAGCTTGCCCAAGGTCCCAGGTCCATCCATCTGCTTCCGGTATCCATGCC
    CTCTGCAGGTCACATGTTTGAGGCTGTGGCCCACCTATTCTACCTAGGGGCACAGTACTGGGCCCTTACC
    TAGGGGGTCATCAAGGGTGGTGATGCCTCCCAGTTCCTTTGTTTGTGGGACACTGCTTTCCACTCTGGCC
    ACCTGTAAAGGCTTCTCGGACTCCTGGTTCTGCTGCTTACCTAAGTATTTCTGGCAGTCCTCCTCTGTGG
    AGAAGAGAAGGGTGTAGAGGCTCCTCCTCCCACCCCATCCCCGACACCCCCGCCCCCCATGCCCCAGGTT
    GCTGCTGTACACACACTCAAAATCCTGAATTAGTTTAAAGAGCCTACTTGGGGCTGGCGAGATGGCTCAG
    CCGGTAAGAGCACTGACTGCTCTTCCGAAGGTCCTGAGTTCAAATCCCACAACCACCCATAATGAGATCT
    GACGCCCTTTTCTGGTGTGTCTGCAGGCAGCTACAGTGTACTTATGTATAATAATAAATAAATGTTAAAA
    AAAAAATTTAAAAAGGGCCTACTTGGGCCGAGCCTTCCCCAGCCACTGGTACCATGGATGGCTCTACAAA
    CTAACACTTCCTTTTGGACTCTCCCAAAATGAGCATCTGAGAGGACTCCAAAGTCAGCCTGCTTCTCTGA
    GCCTTCCTCCTGCCTTCCCTTTCTAAGGCTCTAGAGAATGGAGCCAAACTGGGCATCTAGCAGGGCACAG
    AGCAATCGGAGCAGAGGATTGAATGTCAGAAGGGCTCAGGCACCCAGTTAGTGCTCAATGAGAATGGTGA
    CCCCCATCTAGCAAGGTGTACCTCACTGTGGGCGGGGCGGGGGTGTTGTGCTGAGTGCCAGTGAGTGATG
    GAAGGGGTCCTCACTTGTCCGGTTGATCCTGACACAACTGAGATACCGCGAGAAAAGCAGATCTTGACTC
    TTGGTACAACTGAAGGTCTTTGCCTAGGCTCTTTCCATCTTTCCTCAGGGTTTTTGACCCCTCTCCCAAT
    CCCTACGCTGACCTGCATACTGACAGAAAATTCGACTGTCACTCTCTTCCTCCCTAGCGCACCCCAGAAA
    AAAATGAACAAGATTAATATGCCAAGGCTAGCCTCGTTGATCCTTGGCACAAAGCCAGGAAGCACGTTTC
    CTCACCGATGCGCGACTTCAGCTCCTTCAGTATATCCTCACGGTCTAACAAGGCCAGCAGCTCTAGCAGC
    CTGCCGACAGACGCGCCAGAGCGCCCCTGCCAGGCATCCAACAAACTGCGAGTGGGGTCAGGGCGCGTTT
    CCAGCTCTCGGATCTCCAAGTACTCGAAGCCCATCTCCTCCGCCAGCAAGGTCCAGTCGGCCGCCACGGG
    CGTCCGAGGGTTCAAGAACAGCGATAGGCGGCGCCTCACTCCCACGTTAAGCGCGACCAAGGGTATGGAG
    AACATGAAGGAGTCCAGGGACCCGGATCCCACGCGGGGGTCTCCCGCAGACATGGCAGGCAACCCTGGGC
    CCCCGGTGCCGTCCAGTACGCTCGCCTGTGGAGTTTCCTACTTCCCTTAAGTCTCCTGCCAGC
  • Protein Sequence : Show Sequence
    >gi|6754772|ref|NP_034981.1| myeloid differentiation primary response protein MyD88 [Mus musculus]
    MSAGDPRVGSGSLDSFMFSIPLVALNVGVRRRLSLFLNPRTPVAADWTLLAEEMGFEYLEIRELETRPDP
    TRSLLDAWQGRSGASVGRLLELLALLDREDILKELKSRIEEDCQKYLGKQQNQESEKPLQVARVESSVPQ
    TKELGGITTLDDPLGQTPELFDAFICYCPNDIEFVQEMIRQLEQTDYRLKLCVSDRDVLPGTCVWSIASE
    LIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPC
    TKSWFWTRLAKALSLP
  • Molecule Role : Other
  • Molecule Role Annotation : Female MyD88−/− mice on a C57BL/6 background were grown under specific pathogen-free conditions at the University of Michigan (Rudd et al., 2007).
10. Par1
  • Gene Name : Par1
  • VO ID : VO_0011301
  • NCBI Protein GI : 2209137
  • Other Database IDs : CDD:113902
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : paraflagellar rod component
  • Protein Length : 595
  • Protein Note : Paraflagellar rod protein; pfam05149
  • Protein Sequence : Show Sequence
    >gi|2209137|gb|AAC32021.1| paraflagellar rod component [Trypanosoma cruzi]
    MTVYHEQFALVPPQYPRRAVQEAENHRALAALYELVENAIATAENYVAYTEGRLVPLSSRGSELLAASKE
    LRERYRHEAPCGWTEQKVMQHCEQEVTVEEMAELLLRPPLDVAGIRSILRTLQETRTQLPRGRFLLMRDN
    LSALKPHQPPDLARDLSDVCGALYEIQYVDLMAELRAELSELDGERDKVQEKLKDAIHLYERAVAKGDVV
    EVERAHRQLIAARYEFVNACAKLMHQILGEDMASQESGFAAEMEALRRDAADSISRFAEALHERRQAFRN
    DLHNCDKKRLEEDGNHQKCLEVYNAEERETAAQIGQIVEQKKKLVEELRQKARELRDITLKQKEMVEAQV
    RAKRAEEERVTAYNEFVNMEEQQKHRLLRCLAYFDGMEELTADLRSYVDEMVTRIPQQNLRQVLDQLNDI
    EAEVFMNAYGGFVSCCGELTVKKMHRLDTLERQARLLEHNRDSAMESLDPNMSNYRLELDDIIEQMKGVS
    GVINALNATQDAGEQLFQSVEKGVLAKYERSGTPFVHPLQEYGIKSVEERNRFVDRSMHYVENEERKVLE
    KRNVLNRMRQAVEEDEAATESAIRNLNEEPAAPEY
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : C57BL/6 mice were immunized s.c. with recombinant PFR-1 (PAR1) protein co-adsorbed to alum with rIL-12. rPFR-1 immunized animals were able to successfully resolve parasitemia by day 30 p.i., with the peak parasitemia occurring between days 17 and 21 p.i. (Luhrs et al., 2003).
  • Related Vaccine(s): T. cruzi PAR1 Protein Vaccine
11. protein G4
  • Gene Name : protein G4
  • Sequence Strain (Species/Organism) : Trypanosoma cruzi
  • VO ID : VO_0011298
  • NCBI Protein GI : 52424038
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : protein G4
  • Protein Length : 91
  • Protein Sequence : Show Sequence
    >gi|52424038|gb|AAU47268.1| protein G4 [Trypanosoma cruzi]
    MSAKAPPKTLHQVRNVAYIFAAWAGLQKGFAEKSANDKMWVEHQRRLRQENAKRQHAAHALEELKQDEEL
    ERSIPTIVPKELHELVKALEK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The vaccine efficacy of a putative candidate antigen against T. cruzi infection and disease in a mouse model. C57BL/6 mice vaccinated with a T. cruzi G4-encoding plasmid and cytokine (interleukin-12 and granulocyte-macrophage colony-stimulating factor) expression plasmids elicited a strong Th1-type antibody response dominated by immunoglobulin G2b (IgG2b)/IgG1 isotypes. The dominant IgG2b/IgG1 antibody response was maintained after a challenge infection and was associated with 90% control of the acute-phase tissue parasite burden and an almost undetectable level of tissue parasites during the chronic phase, as determined by a sensitive T. cruzi 18S rRNA gene-specific real-time PCR approach (Bhatia and Garg, 2008).
  • Related Vaccine(s): T. cruzi DNA Vaccine encoding G4 Protein
12. Tc00.1047053434931.10
  • Gene Name : Tc00.1047053434931.10
  • Sequence Strain (Species/Organism) : Trypanosoma cruzi strain CL Brener
  • VO ID : VO_0011300
  • NCBI Gene ID : 3532027
  • NCBI Protein GI : 71398801
  • Locus Tag : Tc00.1047053434931.1
  • Genbank Accession : AAHK01004051
  • Protein Accession : XP_802646
  • Taxonomy ID : 353153
  • Gene Starting Position : 93194
  • Gene Ending Position : 93988
  • Gene Strand (Orientation) : +
  • Protein Name : paraxonemal rod protein PAR2
  • Protein pI : 6.21
  • Protein Weight : 29966.04
  • Protein Length : 264
  • DNA Sequence : Show Sequence
    >ref|NW_001849495.1|:93194-93988 Trypanosoma cruzi strain CL Brener 1047053517073 genomic scaffold, whole genome shotgun sequence
    NCAGGACGAGGCGTGGCGCCGCATCCAGGAGCTCGAGCGTGTCCTGCAGCGTCTGGGGACGGAGCGATTT
    GAGGAGGTGAAGCGCCGCATTGAGGAGAACGACCGCGAGGAGAAGCGCAAGGTGGAGTACCAGCAGTTCC
    TGGATGTATGTGGGCAGCACAAGAAGCTGCTGGAGCTGTCGGTGTACAACTGCGACCTGGCGATGCGATG
    CATCGGGATGATGGAGGAGCTGGTGGCGGAGGGCTGCAGCGCAATCAAGTCGCGCCACGACAAGACGAAC
    GAGGAGCTGGGGGACCTGCGGCTGCAGGTGCATCAGGAGTACCTGGAGGCGTTCCGCCGCCTGTACAAGA
    CGCTGGGCCAGCTGGTGTACAAGAAGGAGAAGCGCCTGGAGGAGATTGACCGCAACATCCGCACGACGCA
    CATTCAGCTGGAGTTTGCCATCGAGACGTTTGACCCGAACGCGAAGAAGCACTCGGACGCCAAGAAGGAG
    CTGTACAAGCTCCGCGCGCAGGTGGAGGAGGAGCTGGAGATGCTGAAGGACAAGATGGCGCAGGCGCTGG
    AGATGTTTGGCCCGACCGAGGACGCGCTGAACCAGGCCGGCATTGAGTTTGTGCATCCCGCCGAGGAGGT
    GGAGGACGGCAACCTGACCCGCCGCAGCAAGATGGTCGAGTACCGTGCCCACCTGGCGAAGCAGGAGGAG
    GTGAAGATTGCGGCGGAGCGCGAGGAACTGAAGCGCTCCAAGACACTGCAGAGCCAGCAGTACCGCGGCA
    AGACGGTGCAGCAGATCACACAGTA
  • Protein Sequence : Show Sequence
    >gi|71398801|ref|XP_802646.1| paraxonemal rod protein PAR2 [Trypanosoma cruzi strain CL Brener]
    QDEAWRRIQELERVLQRLGTERFEEVKRRIEENDREEKRKVEYQQFLDVCGQHKKLLELSVYNCDLAMRC
    IGMMEELVAEGCSAIKSRHDKTNEELGDLRLQVHQEYLEAFRRLYKTLGQLVYKKEKRLEEIDRNIRTTH
    IQLEFAIETFDPNAKKHSDAKKELYKLRAQVEEELEMLKDKMAQALEMFGPTEDALNQAGIEFVHPAEEV
    EDGNLTRRSKMVEYRAHLAKQEEVKIAAEREELKRSKTLQSQQYRGKTVQQITQ
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : C57BL/6 mice were immunized s.c. with recombinant PFR-2 (PAR2) protein co-adsorbed to alum with rIL-12. rPFR-2 immunized animals were able to successfully resolve parasitemia by day 30 p.i., with the peak parasitemia occurring between days 17 and 21 p.i. (Luhrs et al., 2003).
  • Related Vaccine(s): T. cruzi PAR2 Protein Vaccine
13. Tc24 from Trypanosoma cruzi
  • Gene Name : Tc24 from Trypanosoma cruzi
  • Sequence Strain (Species/Organism) : Trypanosoma cruzi
  • NCBI Protein GI : 77167273
  • Other Database IDs : CDD:34727
    CDD:28933
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : Tc24 protein
  • Protein Length : 167
  • Protein Note : Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]; COG5126
  • Protein Sequence : Show Sequence
    >gi|77167273|gb|ABA62611.1| Tc24 protein [Trypanosoma cruzi]
    RKEAWERIRQAIPREKTAEAKQRRIELFKKFDKNETGKLCYDEVHSGCLEVLKLDEFTPRVRDITKRAFD
    KARALGSKLENKGSEDFVEFLEFRLMLCYIYDFFELTVMFDEIDASGNMLVDEEEFKRAVPKLEAWGAKV
    EDPAALFKELDKNGTGSVTFDEFAAWA
  • Molecule Role : Protective antigen
  • Related Vaccine(s): T. cruzi DNA vaccine encoding TSA-1 and Tc24
14. TS
  • Gene Name : TS
  • Sequence Strain (Species/Organism) : Trypanosoma cruzi
  • VO ID : VO_0011294
  • NCBI Protein GI : 258547365
  • Other Database IDs : CDD:92329
    CDD:140355
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : trans-sialidase
  • Protein Length : 322
  • Protein Note : Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates as well as playing roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold...; cl01922
  • Protein Sequence : Show Sequence
    >gi|258547365|gb|ACV74334.1| trans-sialidase [Trypanosoma cruzi]
    THPLNFKGRWLRDRLNLWLTDNQRIYNVGQVSIGDENSAYSSVLYKDDKLYCLHEINTNEVYSLVFARLV
    GELRIIKSVLQSWKNWDSHLSSICTPADPAASSSERGCGPAVTTVGLVGFLSGNASQNVWEDAYRCVNAS
    TANAERVPNGLKFAGVGGGALWPVSQQGQNQRYRFANHAFTLVASVTIHEVPSVASPLLGASLDSSGGKK
    LLGLSYDEKHQWQPIYGSTPVTPTGSWETGKRYHVVLTMANKMGSVYIDGEPLEGSGQTVAPDERTPDIS
    HFYVGGYKRSDMPTISHVTVNNVLLYNRQLNAEEIRTLFLSQ
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : To develop a vaccine strategy taking advantage of activated CD8(+)T cells,a DNA vaccine, designated pGFP-TSA1, encoding a fusion protein linking GFP to a single CTL epitope of TSA1(TS), a leading candidate for vaccine against T. cruzi was constructed. C57BL/6 mice vaccinated with this plasmid showed suppressed parasitemia and prolonged survival. Vaccination with pGFP-TSA1 enhanced epitope-specific cytotoxicity and IFN-gamma secretion by CD8(+)T cells (Chou et al., 2008).
  • Related Vaccine(s): T. cruzi DNA Vaccine pGFP-TSA1 , T. cruzi DNA vaccine pTS encoding T. cruzi antigens
15. TS from strain Y
  • Gene Name : TS from strain Y
  • Sequence Strain (Species/Organism) : Trypanosoma cruzi strain Y
  • NCBI Protein GI : 840708
  • Other Database IDs : CDD:29333
    CDD:205269
    CDD:205563
    CDD:192582
    CDD:191002
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : trans-sialidase
  • Protein Length : 1060
  • Protein Note : Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates as well as playing roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold...; cd00260
  • Protein Sequence : Show Sequence
    >gi|840708|dbj|BAA09334.1| trans-sialidase [Trypanosoma cruzi]
    MGKTVVGASRMFWLMFFVPLLLALCPSEPAHALAPGSSRVELFKRQSSKVPFEKGGKVTERVVHSFRLPA
    LVNVDGVMVAIADARYETSNDNSLIDTVAKYSVDDGETWETQIAIKNSRASSVSRVVDPTVIVKGNKLYV
    LVGSYNSSRSYWTSHGDARDWDILLAVGEVTKSTAGGKITASIKWGSPVSLKEFFPAEMEGMHTNQFLGG
    AGVAIVASNGNLVYPVQVTNKKKQVFSKIFYSEDEGKTWKFGEGRSDFGCSEPVALEWEGKLIINTRVDY
    RRRLVYESSDMGNSWVEAVGTLSRVWGPSPKSNQPGSQSSFTAVTIEGMRVMLFTHPLNFKGRWLRDRLN
    LWLTDNQRIYNVGQVSIGDENSAYSSVLYKDDKLYCLHEINSNEVYSLVFARLVGELRIIKSVLQSWKNW
    DSHLSSICTPADPAASSSERGCGPAVTTVGLVGFLSHSATKTEWEDAYRCVNASTANAERVPNGLKFAGV
    GGGALWPVSQQGQNQRYHFANHAFTLVASVTIHEVPSVASPLLGASLDSSGGKKLLGLSYDEKHQWQPIY
    GSTPVTPTGSWEMGKRYHVVLTMANKIGSVYIDGEPLEGSGQTVVPDGRTPDISHFYVGGYGRSDMPTIS
    HVTVNNVLLYNRQLNAEEIRTLFLSQDLIGTEAHMGSSSGSSAHSTPSTPADNGAHSTPSTPADSSAHST
    PSTPADSSAHSTPSAPGDNGAHSTPSTPGDSSAHSTPSTPADNGAHSTPSAPADSNAHSTPSTPADNGAH
    STPSTPADNGAHSTPSTPGDNGAHSTPSTPGDSSAHSTPSTPADNGAHSTPSAPADSNAHSTPSTPGDNG
    AHSTPSAPADSNAHSTPSTPADSSAHSTPSAPGDNGAHSTPSAPADSSAHSTPSAPGDNGAHSTPSAPAD
    NGAHSTPSAPGDSNAHSTPSTPADSSAHSTPSTPADSSAHSTPSAPGDNGAHSTPSAPADSSAHSTPSIP
    GDSSAHSTPSAPADSSAHSTPSAPGDNGAHSTPSTPADNGANGTVLILHDGAAFSAFSGGGLLLCAGALL
    LHVFVMAVFF
  • Molecule Role : Protective antigen
16. TSA-1
  • Gene Name : TSA-1
  • VO ID : VO_0011296
  • NCBI Protein GI : 162315
  • Other Database IDs : CDD:29333
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : trypomastigote surface glycoprotein
  • Protein Length : 835
  • Protein Note : Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates as well as playing roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold...; cd00260
  • Protein Sequence : Show Sequence
    >gi|162315|gb|AAA30259.1| trypomastigote surface glycoprotein [Trypanosoma cruzi]
    MSRRHFYSAVLLLLLVVMVCGGSGAAHAVERNSGDLQLPQEIAMLVPNKTQVVPKSGGEGKVKDIFASPA
    LVRAGGVMIAFVEGRTKNKLFPEVIDLSSSDIVAGYIKAPETWQSLVAEVTKEYWQAHTVLESANNSNHR
    VGVARLPTGITRGNKVFLLVGSYEERREIDDYIWKAEAWNIKVIEGEATQSTEVQPTQPINWSEPKPLFQ
    TDSPNNKGDLKEFLGGGGSGIVMGNGTLVFPLTAKDESNKVFSLITYSTDDGQKWEIPGGVSSVACRSPR
    VTEWEEGTLLMVTYCEDGRKVFESRDMGKTWTEAFGTLPGVWLKSGPELPEVSLRVDALITATIEGRKVM
    LYTQKVRHFLEVDEPNALHLWVTDNNRTFHLGPFSVDCAENKTFANTLLYSDDALHLLQAKGDHESTAVS
    LARLTEELNTINSVLSTWVQLDASFSESSIPTAGLVGFLSNTTSSGDTWIDGYRCMNATVTKAAKVENGF
    KFTGPGSRATWPVNSRWDIKQYGFVDYNFTIVAMATIHQVPSESTPLLGASLRGNKRTKLIGLSYGAGGK
    WETVYDGTKTVQGGTWEPGREYQVALMLQDGNKGFVYVDGVLVGNPAMLPTPEERWTEFSHFYFGGDEGD
    SGSDATLTDVFLYNRPLSVGELKMIKEVEDKKEKGSGDSEDKKESGDSEDKKESGDSEDKKGSGDSEDKK
    ESGDSEDKKESGDSEDKKGSGDGAFTPAVSNATTHTAEEETVNQSASGTFSITDSTEGDVSSDENGETTG
    GADGQEEDIQPQDGEANAAALGLALKSSLGTSSQWDGSVAGTMRESRVLLPSLFLLLGLWGFAAL
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Following the intramuscular immunization of H-2(b) and H-2(d) mice with a plasmid DNA encoding an N-terminally truncated TSA-1 lacking or containing the C-terminal nonapeptide tandem repeats, the antibody level, CTL response, and protection against challenge with T. cruzi were assessed. In H-2(b) mice, antiparasite antibodies were induced only by immunization with the DNA construct encoding TSA-1 containing the C-terminal repeats. However, both DNA constructs were efficient in eliciting long-lasting CTL responses against the protective H-2Kb-restricted TSA-1515-522 epitope. In H-2(d) mice, inoculation with either of the two TSA-1-expressing vectors effectively generated antiparasite antibodies and primed CTLs that lysed T. cruzi-infected cells in an antigen-specific, MHC class I-restricted, and CD8(+)-T-cell-dependent manner. When TSA-1 DNA-vaccinated animals were challenged with T. cruzi, 14 of 22 (64%) H-2(b) and 16 of 18 (89%) H-2(d) mice survived the infection (Wizel et al., 1998).
  • Related Vaccine(s): T. cruzi DNA vaccine encoding TSA-1 and Tc24 , T. cruzi DNA Vaccine encoding TSA-1 protein , T. cruzi DNA vaccine encoding TSA-1, ASP-1, ASP-2
17. TSA-1
  • Gene Name : TSA-1
  • Sequence Strain (Species/Organism) : Trypanosoma cruzi strain Peru
  • NCBI Nucleotide GI : 3599494
  • NCBI Protein GI : 3599495
  • Protein Accession : AAD13347.1
  • Taxonomy ID : 5693
  • Gene Strand (Orientation) : ?
  • Protein Name : surface glycoprotein Tc85-11
  • DNA Sequence : Show Sequence
    >gi|3599494|gb|AF085686.1| Trypanosoma cruzi surface glycoprotein Tc85-11 (Tc85-11) mRNA, complete cds
    ATGTCCCGGCGTGTGTTTGCTTCTGCGGTGCTGCTCCTCCTCCTCGTGTTGTGCTGCGACCGTGGAGCTA
    CGACCGCTCAGGTGGAAAAGGCCACTGATGCCTCAACTCCTTCTGGGTCGGCTTTGACGGGTGCCATTAC
    TGCAGCGGGGAGTGCTTCAGGGAGTGTTGAGTTGCCGCAGGAGTCGATCCTATTTGTTCCGCAGACGACG
    CAGGTGCTGCAGAAGACGGGGACTGGCTCAAGTGGGAGGGATTCATTTGTTTCACCCTCTCTCGTCAGTG
    CTGGTGGAGTAATTGCTGCTTTTGCTGAAGGTCGCATAAATGCCAAAAACACCTCCCCTACCGAATCAAC
    TAAGCCGTCTTCTGATGTTGTTGCGGAGTACATCGACTCTGCGTGGGAATGGTCCACTCTTGTCGAAAAG
    GTCAAAAAGAAAGAATGGAGGGCACGCACCGTGCTTGGTAAAGCGGAGGGAAATGAGAGTTTTGATGTTG
    TTGTGCGCCACCCCACAACAATCATGAAGGGCAATAAGGTGTTTCTTCTTGTGGGAAGCACTGCCTTGTC
    CGTTGTAAATGAGAGTTGGAAAGAGGGCAGCTTGGAAATAAAACTGGTTGTTGGTGAGGTGACGAAGCCC
    ACGGACAGCGAGCCGAGTAAACGGATCGAATGGGGCGAAATCAACTCTCCGTTGAACGGGAGTACTTTAG
    CTGCTCACAAAGGTAAATTGACGGAGTGCCTTGCTTCTGGTGGCTCGGGTGTTCTGATGGAGGATGGCGC
    GCTTGTGTTTTCACTGATGGCGGTGAATGAAAAAAACGATGGCGTTTACTCCATGATTATTTACTCGAAG
    GACAACGGCAGTACCTGGGCGCTCTCTGAGGACATGTCACCTGCGAACTGCACTGACCCCCGCATCACCG
    AGTGGGAAGGATCACTTCTCATGATTGTTGACTGCGAGAACGAACAGAGGGTGTACGAGTCGTGTGACAT
    GGGGAAAACGTGGACGGAGGCCATCGGGACGCTTCCAGGCGTGTGGGTCAACTCACAGTCGGAAGACTAT
    CCGGAAGGAGTCTTGCGTGTGGATGCCCTCATCACCGCGAGCATTGAGGACAGGAAGGTCATGCTGTACA
    CTCAGAGAGGGTACGCGTCGGGGGGTGAAGCGGAAAGAGCGCTCTATCTTTGGGTGACGGACAACAACCG
    CTCGTTTTTTGTTGGACCGGTTGGCATGGACAATGCTGTGAGTGGGGATCTCACCAGCAGCCTGCTGTAC
    TCGGATGGCAAGTTGCATCTTTTACAACGGAGGGGCAACAGTGAACGCAGTGTCATCTCACTTTCCCGCC
    TGACGGAGGAACTGAGTACAATCAATTCTGTCCTGAAGACCTGGGCGCAAAATGACGCCTTTTTCTCCAA
    CTTGTCTATACCCACGGCGGGTCTGGTGGCGGTATTGTCAAACGCATCGGCCAGCGGTGACACGTGGAAC
    GACGAGTACCTTTGCCTGAATGCAACGGTGAAAAACGCCACGAAGGTCAAGGATGGGTTTCAATTGCAGG
    AGCCTGACTCCAGGGCAATATGGCCCGTGAACACTCAGGGTGATAATGTGCGTCATATATCTTTGAGCCA
    CAACTTCACACTTGTGGCGTCGGTGACCATCGAAGAGGCCCCGAGCGAGAAAACTCTACTGACTGCGGTG
    TTGGGGAACACTGAGCCCCCGTATATCATGAGACTGTCGTACACCGCGGATAACAAGTGGGAGACTATGC
    TCAAGGACGAGAAAACAACACGGAGGAGCACTTGGGAGCTTAAGAAAGAATACCAAGTGGCACTCATGCT
    GCAAGGCAACAAGAGATCCGTGTACGTTGATGGTGAGTTGCTGGGGGAAGAAGAAGTGCCGTTAACAGGT
    GAGACACCACTTGAGCCTTTTGGGTTTTGCTTTGGCGCGTGCGGTGAGGATGATGATGGGGAGGAGCCCA
    GTCCGGAGGAGATCGGCAAAAAACCTCGTGTGACGGTGACGAACGTCTTTCTGTACAACCGCCCACTGAA
    TTCCACTGAGATGACTGCAATCAAGGACAGGAAACCCGTTCCGAAGAGAGCTCCAGAACCACAAGTGAAA
    ATTGTTCCTAATCCTGTCGCACCTGCTGTGTCTGCTGTACCTGGCCCACGGGAATTACCAGCAGCACCGG
    GGAGGACAACTGTGGGGAGAACCGCCAATACCCAACATGCGCCAGCGGGACGCTTGACTTCTGCTGGGAA
    TGAAGGGACGGCACGAGAAAAGGGTGATGGTGGGGCAAATGGTGATGCTGGTTCCGCGTACGGGAGGGAA
    CTGCTGCCGATGCTGCTTCTGCTGGGACTGTGGGCCCTTGCGACTGCGTGA
  • Molecule Role : Protective antigen
III. Vaccine Information
1. T. cruzi DNA vaccine encoding ASP-2
a. Vaccine Ontology ID:
VO_0004375
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of amastigote surface protein-2
  • Type: DNA vaccine construction
  • Description: Vector pGEX-3X expressed amastigote surface protein 2 (ASP-2 ) (Araújo et al., 2005).
  • Detailed Gene Information: Click here.
f. Vector:
pGEX-3X (Araújo et al., 2005)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Vaccination with a plasmid expressing amastigote surface protein 2 (ASP-2) generates specific CD4+ Th1 and CD8+ Tc1 immune responses (Araújo et al., 2005).
  • Efficacy: DNA vaccination with the gene encoding amastigote surface protein 2 (ASP-2) protects approximately 65% of highly susceptible A/Sn mice against the lethal Trypanosoma cruzi infection (Araújo et al., 2005).
2. T. cruzi DNA Vaccine encoding CRP-10 Protein
a. Type:
DNA vaccine
b. Status:
Research
c. Gene Engineering of CRP-10
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
d. Vector:
pBC12BI (Sepulveda et al., 2000)
e. Immunization Route
Intramuscular injection (i.m.)
f. Mouse Response
  • Host Strain: BALB/c and C3H/HeJ
  • Vaccination Protocol: 100 μg of pBC12BI.crp-daf DNA or vector DNA was dissolved in 50 μl of PBS and injected intramuscularly in the tibialis anterior muscles of mice that had been briefly anesthetized by metaphane inhalation (Sepulveda et al., 2000).
  • Challenge Protocol: BALB/c mice immunized with DNA were challenged intravenously (i.v.) 2 weeks after the last boost with 2 × 106 T. cruzi strain Y trypomastigotes (Sepulveda et al., 2000).
  • Efficacy: Mice immunized with the crp DNA plasmid produced antibodies capable of lysing the parasites in the presence of complement and were protected against a lethal challenge with T. cruzi trypomastigotes (Sepulveda et al., 2000).
3. T. cruzi DNA Vaccine encoding G2 Protein
a. Type:
DNA vaccine
b. Status:
Research
c. Gene Engineering of G2
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
d. Vector:
pCDNA3
e. Immunization Route
Intramuscular injection (i.m.)
f. Mouse Response
  • Host Strain: C57BL/6
  • Vaccination Protocol: C57BL/6 mice were injected in the quadriceps muscle thrice at 2-week intervals with antigen-encoding plasmid (pCDNA3.TcG2 25 μg per DNA/mouse) and cytokine-encoding plasmids (pcDNA3.msp35, pcDNA3.msp40 [IL-12], and pCMVI.GM-CSF; 25 μg per plasmid DNA/mouse) (Bhatia and Garg, 2008).
  • Challenge Protocol: Two weeks after the last immunization, mice were challenged with culture-derived T. cruzi trypomastigotes (2.5 × 104/mouse, intraperitoneally) and sacrificed at days 30, 75, and 120 postinfection (p.i.), corresponding to the acute phase of peak parasitemia, the intermediate phase of immune control of parasites, and the chronic phase of disease development, respectively (Bhatia and Garg, 2008).
  • Efficacy: The dominant IgG2b/IgG1 antibody response was maintained after a challenge infection and was associated with 50% control of the acute-phase tissue parasite burden and an almost undetectable level of tissue parasites during the chronic phase (Bhatia and Garg, 2008).
4. T. cruzi DNA Vaccine encoding G4 Protein
a. Type:
DNA vaccine
b. Status:
Research
c. Gene Engineering of protein G4
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
d. Vector:
pCDNA3
e. Immunization Route
Intramuscular injection (i.m.)
f. Mouse Response
  • Vaccination Protocol: C57BL/6 mice were injected in the quadriceps muscle thrice at 2-week intervals with antigen-encoding plasmid (pCDNA3.TcG4 25 μg per DNA/mouse) and cytokine-encoding plasmids (pcDNA3.msp35, pcDNA3.msp40 [IL-12], and pCMVI.GM-CSF; 25 μg per plasmid DNA/mouse) (Bhatia and Garg, 2008).
  • Challenge Protocol: Two weeks after the last immunization, mice were challenged with culture-derived T. cruzi trypomastigotes (2.5 × 104/mouse, intraperitoneally) and sacrificed at days 30, 75, and 120 postinfection (p.i.), corresponding to the acute phase of peak parasitemia, the intermediate phase of immune control of parasites, and the chronic phase of disease development, respectively (Bhatia and Garg, 2008).
  • Efficacy: The dominant IgG2b/IgG1 antibody response was maintained after a challenge infection and was associated with 50% control of the acute-phase tissue parasite burden and an almost undetectable level of tissue parasites during the chronic phase (Bhatia and Garg, 2008).
5. T. cruzi DNA vaccine encoding TSA-1 and Tc24
a. Vaccine Ontology ID:
VO_0004532
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Dogs
e. Gene Engineering of Tc24 from Trypanosoma cruzi
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Gene Engineering of TSA-1
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Vector:
pcDNA3.1 (Quijano-Hernández et al., 2013)
h. Immunization Route
Intramuscular injection (i.m.)
i. Dog Response
  • Efficacy: Both preventive and therapeutic vaccination significantly reduced parasitemia, cardiac inflammation and cardiac parasite burden, and tended to reduce the development of cardiac arrhythmias (Quijano-Hernández et al., 2013).
6. T. cruzi DNA Vaccine encoding TSA-1 protein
a. Type:
DNA vaccine
b. Status:
Research
c. Gene Engineering of TSA-1
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
d. Vector:
VR1012 (Vical Inc., San Diego, Calif.)
e. Immunization Route
Intramuscular injection (i.m.)
f. Mouse Response
  • Host Strain: B6 and BALB/c
  • Vaccination Protocol: Groups of B6 and BALB/c mice were injected intramuscularly into each tibialis anterior muscle with 50 μg of VR1012 TSA1.7, VR1012 TSA2.1, or control VR1012 suspended in 50 μl of PBS by using a 27-gauge needle. Mice were boosted 4 weeks later with an identical dose of plasmid (100 μg total) given by the same bilateral intramuscular injection (Wizel et al., 1998).
  • Challenge Protocol: Two weeks after the second dose, animals were infected by intraperitoneal injection of 105 (B6) or 103 (BALB/c) T. cruzi BFT. Parasitemias were monitored periodically by hemacytometer counts of 10 μl of tail vein blood in an ammonium chloride solution (Wizel et al., 1998).
  • Efficacy: When TSA-1 DNA-vaccinated animals were challenged with T. cruzi, 14 of 22 (64%) H-2(b) and 16 of 18 (89%) H-2(d) mice survived the infection (Wizel et al., 1998).
7. T. cruzi DNA vaccine encoding TSA-1, ASP-1, ASP-2
a. Vaccine Ontology ID:
VO_0004374
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of TSA-1
f. Gene Engineering of amastigote surface protein-2
g. Gene Engineering of ASP1
h. Vector:
pCMVI.UBF3/2 (Garg and Tarleton, 2002)
i. Immunization Route
Intramuscular injection (i.m.)
j. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Immunization of mice with plasmids encoding ASP-1, ASP-2, or TSA-1 elicited poor antigen-specific cytotoxic-T-lymphocyte (CTL) activity and T. cruzi-specific antibody responses. Codelivery of interleukin-12 and granulocyte-macrophage colony-stimulating factor plasmids with antigen-encoding plasmids resulted in a substantial increase in CTL activity and antibody production and in increased resistance to T. cruzi infection (Garg and Tarleton, 2002).
  • Efficacy: Immunization with this mixture of ts-encoding plasmids elicited moderate parasite-specific antibody responses and substantial CTL activity and subsequently provided significant resistance to T. cruzi infection. In conclusion, genetic vaccines composed of ASP-1, ASP-2, and TSA-1 provide partial protection from lethal T. cruzi infection (Garg and Tarleton, 2002).
8. T. cruzi DNA Vaccine pGFP-TSA1
a. Vaccine Ontology ID:
VO_0001390
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of TS
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
pGFP plasmid (Clontech, Palo Alto, CA)
f. Immunization Route
Gene Gun
g. Mouse Response
  • Host Strain: C57BL/6
  • Vaccination Protocol: B6 mice were immunized four times at two-week intervals with 6 μg of each plasmid using a Helios Gene Gun (BioRad, NY, USA) (Chou et al., 2008).
  • Challenge Protocol: Two weeks after the last vaccination, mice were infected with 1000 blood-derived T. cruzi trypomastigotes by s.c. injection at the base of the tail. Parasitemia levels were evaluated by counting the number of parasites in 5 μl of blood from the tail vein (Chou et al., 2008).
  • Efficacy: C57BL/6 mice vaccinated with this plasmid showed suppressed parasitemia and prolonged survival. Vaccination with pGFP-TSA1 enhanced epitope-specific cytotoxicity and IFN-gamma secretion by CD8(+)T cells (Chou et al., 2008).
9. T. cruzi DNA vaccine pTS encoding T. cruzi antigens
a. Vaccine Ontology ID:
VO_0004377
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of TS
  • Type: DNA vaccine construction
  • Description: Vector pcDNA3 expressed T. cruzi antigens, including trans-sialidase (TS) (Eickhoff et al., 2011).
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3.1 (Eickhoff et al., 2011)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Vaccination of mice with pTS alone or pTS + pIL-15 elicited strong TS-specific T cell responses as detected 3 months after vaccination. In addition to enhancing TS-specific CD8+ T cell responses, the pIL-15 adjuvant enhanced TS-specific CD4+ T cell responses induced by pTS vaccination (Eickhoff et al., 2011).
  • Efficacy: We challenged 5 mice per group with a lethal dose of T. cruzi BFT (5,000 BFT s.c.) 30 days following the final immunization, and followed survival for >2 months. All mice vaccinated with pTS (with or without pIL-15 co-immunization) survived lethal T. cruzi challenge, whereas all mice vaccinated with pIL-15 alone died (Eickhoff et al., 2011).
10. T. cruzi DNA vaccine pUB-ASP-2
a. Vaccine Ontology ID:
VO_0004376
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of amastigote surface protein-2
  • Type: DNA vaccine construction
  • Description: Vector pcDNA3.1 expressed amastigote surface protein 2 (ASP-2 ) (Chou et al., 2010).
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3.1 (Chou et al., 2010)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: The absolute number of both IFN-γ+CD8+ T cells and GZM-b+CD8+ T cells in the spleen was significantly higher in pUB-ASP-2 immunized mice. Immunization with pUB-ASP-2 promotes CD8+ T cell activation, and enhances the expression level of IFN-γ and GZM-b in CD8+ T cells (Chou et al., 2010).
  • Efficacy: After being challenged with T. cruzi, mice immunized with pUB-ASP-2 developed a lower parasitemia than control pcDNA immunized groups; survival was also prolonged by immunization with pUB-ASP-2. Six out of seven pUB-ASP-2 immunized mice survived until the end of the experiment (Chou et al., 2010).
11. T. cruzi PAR1 Protein Vaccine
a. Vaccine Ontology ID:
VO_0001391
b. Type:
Subunit vaccine
c. Status:
Research
d. Gene Engineering of Par1
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
e. Adjuvant: aluminum vaccine adjuvant
f. Adjuvant: IL-12 vacince adjuvant
g. Immunization Route
Subcutaneous Injection
h. Mouse Response
  • Host Strain: C57BL/6
  • Vaccination Protocol: Six-to-eight-week-old female C57BL/6 mice were immunized by subcutaneous (s.c.) injection of 40 μg of pPFR or rPFR proteins co-adsorbed to alum with 0.5 μg recombinant murine IL-12 and were boosted twice at 2-week intervals with 20 μg protein co-adsorbed to alum with 0.5 μg rIL-12 (Luhrs et al., 2003).
  • Challenge Protocol: Two weeks after the last injection, mice were challenged with s.c. injection of 102 bloodstream Peru strain trypomastigotes (Luhrs et al., 2003).
  • Efficacy: rPFR-1 immunized animals were able to successfully resolve parasitemia by day 30 p.i., with the peak parasitemia occurring between days 17 and 21 p.i. (Luhrs et al., 2003).
12. T. cruzi PAR2 Protein Vaccine
a. Vaccine Ontology ID:
VO_0001392
b. Type:
Subunit vaccine
c. Status:
Research
d. Gene Engineering of Tc00.1047053434931.10
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
e. Adjuvant: aluminum vaccine adjuvant
f. Immunization Route
Subcutaneous Injection
g. Mouse Response
  • Host Strain: C57BL/6
  • Vaccination Protocol: Six-to-eight-week-old female C57BL/6 mice were immunized by subcutaneous (s.c.) injection of 40 μg of pPFR or rPFR proteins co-adsorbed to alum with 0.5 μg recombinant murine IL-12 and were boosted twice at 2-week intervals with 20 μg protein co-adsorbed to alum with 0.5 μg rIL-12 (Luhrs et al., 2003).
  • Challenge Protocol: Two weeks after the last injection, mice were challenged with s.c. injection of 102 bloodstream Peru strain trypomastigotes (Luhrs et al., 2003).
  • Efficacy: rPFR-2 immunized animals were able to successfully resolve parasitemia by day 30 p.i., with the peak parasitemia occurring between days 17 and 21 p.i. (Luhrs et al., 2003).
13. T. cruzi vaccine using attenuated Salmonella expressing T. cruzi Cruzipain
a. Vaccine Ontology ID:
VO_0001393
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Gene Engineering of Cruzipain
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
e. Adjuvant: IL-12 vacince adjuvant
f. Vector:
χ4550 attenuated Salmonella enterica serovar Typhimurium strain
g. Immunization Route
Intranasally
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Mice were vaccinated four times intranasally with control and cruzipain-expressing salmonella cells. The mice were lightly anesthetized with ketamine-xylazine given intraperitoneally, and salmonella vaccines were administered in 10-μl volumes of PBS. A total of 2 × 106 CFU of salmonella was given for primary vaccinations, and 2 × 107 CFU of salmonella was given for booster vaccinations. The second vaccinations were given 4 weeks after the priming doses, and the three booster vaccinations were given at 2-week intervals (Schnapp et al., 2002).
  • Challenge Protocol: One month after the final vaccinations, the mice were challenged orally with 2,000 T. cruzi IMT (Schnapp et al., 2002).
  • Efficacy: As early as 15 days after immunization, the parasitemias detected in the cruzipain-immunized group were significantly lower than those in the phage10-immunized and unimmunized groups. Significantly reduced parasitemias persisted in the cruzipain-immunized group throughout the remainder of the first month postchallenge (Schnapp et al., 2002).
14. T. cruzi vaccine using Sendai virus vector expressing amastigote surface protein-2
a. Vaccine Ontology ID:
VO_0001394
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Antigen
Parasite antigen amastigote surface protein-2 (ASP2) (Duan et al., 2009).
e. Gene Engineering of amastigote surface protein-2
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
recombinant Sendai virus vector rSeV/dF
g. Immunization Route
Intranasally
h. Mouse Response
  • Host Strain: C57BL/6
  • Vaccination Protocol: B6 mice were administrated intranasally with 5 × 106 CIU SeV-GFP or SeV-ASP2 (Duan et al., 2009).
  • Challenge Protocol: For challenge infections, mice were inoculated with 1000 blood-derived trypomastigotes at the base of the tail 2 weeks after immunization (Duan et al., 2009).
  • Efficacy: C57BL/6 mice immunized intranasally with rSeV/dF expressing ASP2 showed significantly suppressed parasitemia and could be protected from lethal T. cruzi challenge (Duan et al., 2009).
IV. References
1. Araújo et al., 2005: Araújo AF, de Alencar BC, Vasconcelos JR, Hiyane MI, Marinho CR, Penido ML, Boscardin SB, Hoft DF, Gazzinelli RT, Rodrigues MM. CD8+-T-cell-dependent control of Trypanosoma cruzi infection in a highly susceptible mouse strain after immunization with recombinant proteins based on amastigote surface protein 2. Infection and immunity. 2005; 73(9); 6017-6025. [PubMed: 16113322].
2. Bhatia and Garg, 2008: Bhatia V, Garg NJ. Previously unrecognized vaccine candidates control Trypanosoma cruzi infection and immunopathology in mice. Clinical and vaccine immunology : CVI. 2008; 15(8); 1158-1164. [PubMed: 18550728].
3. Carabarin-Lima A, et al., 2011: Carabarin-Lima A, González-Vázquez MC, Baylon-Pacheco L, Tsutsumi V, Talamas-Rohana P, Rosales-Encina JL. Immunization with the recombinant surface protein rTcSP2 alone or fused to the CHP or ATPase domain of TcHSP70 induces protection against acute Trypanosoma cruzi infection. journal of vaccines and vaccination. 2011; 1(3); .
4. Chou et al., 2008: Chou B, Hisaeda H, Shen J, Duan X, Imai T, Tu L, Murata S, Tanaka K, Himeno K. Critical contribution of immunoproteasomes in the induction of protective immunity against Trypanosoma cruzi in mice vaccinated with a plasmid encoding a CTL epitope fused to green fluorescence protein. Microbes and infection / Institut Pasteur. 2008; 10(3); 241-250. [PubMed: 18321749].
5. Chou et al., 2010: Chou B, Hiromatsu K, Hisaeda H, Duan X, Imai T, Murata S, Tanaka K, Himeno K. Genetic immunization based on the ubiquitin-fusion degradation pathway against Trypanosoma cruzi. Biochemical and biophysical research communications. 2010; 392(3); 277-282. [PubMed: 20059980].
6. Duan et al., 2009: Duan X, Yonemitsu Y, Chou B, Yoshida K, Tanaka S, Hasegawa M, Tetsutani K, Ishida H, Himeno K, Hisaeda H. Efficient protective immunity against Trypanosoma cruzi infection after nasal vaccination with recombinant Sendai virus vector expressing amastigote surface protein-2. Vaccine. 2009; 27(44); 6154-6159. [PubMed: 19712768].
7. Eickhoff et al., 2011: Eickhoff CS, Vasconcelos JR, Sullivan NL, Blazevic A, Bruna-Romero O, Rodrigues MM, Hoft DF. Co-administration of a plasmid DNA encoding IL-15 improves long-term protection of a genetic vaccine against Trypanosoma cruzi. PLoS neglected tropical diseases. 2011; 5(3); e983. [PubMed: 21408124].
8. Garg and Tarleton, 2002: Garg N, Tarleton RL. Genetic immunization elicits antigen-specific protective immune responses and decreases disease severity in Trypanosoma cruzi infection. Infection and immunity. 2002; 70(10); 5547-5555. [PubMed: 12228281].
9. Limon-Flores et al., 2010: Limon-Flores AY, Cervera-Cetina R, Tzec-Arjona JL, Ek-Macias L, Sánchez-Burgos G, Ramirez-Sierra MJ, Cruz-Chan JV, VanWynsberghe NR, Dumonteil E. Effect of a combination DNA vaccine for the prevention and therapy of Trypanosoma cruzi infection in mice: role of CD4+ and CD8+ T cells. Vaccine. 2010; 28(46); 7414-7419. [PubMed: 20850536].
10. Luhrs et al., 2003: Luhrs KA, Fouts DL, Manning JE. Immunization with recombinant paraflagellar rod protein induces protective immunity against Trypanosoma cruzi infection. Vaccine. 2003; 21(21-22); 3058-3069. [PubMed: 12798650].
11. Quijano-Hernández et al., 2013: Quijano-Hernández IA, Castro-Barcena A, Vázquez-Chagoyán JC, Bolio-González ME, Ortega-López J, Dumonteil E. Preventive and therapeutic DNA vaccination partially protect dogs against an infectious challenge with Trypanosoma cruzi. Vaccine. 2013; 31(18); 2246-2252. [PubMed: 23499599].
12. Rassi et al., 2010: Rassi A Jr, Rassi A, Marin-Neto JA. Chagas disease. Lancet. 2010; 375(9723); 1388-1402. [PubMed: 20399979].
13. Rudd et al., 2007: Rudd BD, Schaller MA, Smit JJ, Kunkel SL, Neupane R, Kelley L, Berlin AA, Lukacs NW. MyD88-mediated instructive signals in dendritic cells regulate pulmonary immune responses during respiratory virus infection. Journal of immunology (Baltimore, Md. : 1950). 2007; 178(9); 5820-5827. [PubMed: 17442966].
14. Sanchez-Burgos et al., 2007: Sanchez-Burgos G, Mezquita-Vega RG, Escobedo-Ortegon J, Ramirez-Sierra MJ, Arjona-Torres A, Ouaissi A, Rodrigues MM, Dumonteil E. Comparative evaluation of therapeutic DNA vaccines against Trypanosoma cruzi in mice. FEMS immunology and medical microbiology. 2007; 50(3); 333-341. [PubMed: 17521394].
15. Schnapp et al., 2002: Schnapp AR, Eickhoff CS, Sizemore D, Curtiss R 3rd, Hoft DF. Cruzipain induces both mucosal and systemic protection against Trypanosoma cruzi in mice. Infection and immunity. 2002; 70(9); 5065-5074. [PubMed: 12183554].
16. Sepulveda et al., 2000: Sepulveda P, Hontebeyrie M, Liegeard P, Mascilli A, Norris KA. DNA-Based immunization with Trypanosoma cruzi complement regulatory protein elicits complement lytic antibodies and confers protection against Trypanosoma cruzi infection. Infection and immunity. 2000; 68(9); 4986-4991. [PubMed: 10948115].
17. Vasconcelos et al., 2004: Vasconcelos JR, Hiyane MI, Marinho CR, Claser C, Machado AM, Gazzinelli RT, Bruña-Romero O, Alvarez JM, Boscardin SB, Rodrigues MM. Protective immunity against trypanosoma cruzi infection in a highly susceptible mouse strain after vaccination with genes encoding the amastigote surface protein-2 and trans-sialidase. Human gene therapy. 2004; 15(9); 878-886. [PubMed: 15353042].
18. Wizel et al., 1998: Wizel B, Garg N, Tarleton RL. Vaccination with trypomastigote surface antigen 1-encoding plasmid DNA confers protection against lethal Trypanosoma cruzi infection. Infection and immunity. 1998; 66(11); 5073-5081. [PubMed: 9784506].