VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Mycobacterium avium

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Introduction
  2. Vaccine Related Pathogen Genes
    1. relA (Virmugen)
  3. Vaccine Related Host Genes
    1. FOXP3
    2. IFNG
    3. IL10
    4. IL17A
    5. IL22
    6. TGFB1
  4. Vaccine Information
    1. M. avium DNA vaccine DNA-Av35/p2AIL12
    2. Mycobacterium avium relA mutant vaccine
  5. References
I. General Information
1. NCBI Taxonomy ID:
1764
2. Introduction
Mycobacterium avium is sometimes found as part of a larger complex called the Mycobacterium avium complex (MAC). MAC is an opportunistic infection that takes advantage of a weakened immune system. It can infect one part of your body, such as your lungs, bones, or intestines. This is called localized infection. It can spread and cause disease throughout your body. This is called disseminated infection. With HIV, MAC infection usually happens only after you receive a diagnosis of AIDS (acquired immunodeficiency syndrome) and when CD4 cell counts drop below 50 (WebMD - Mycobacterium avium complex).
1. relA
  • Gene Name : relA
  • Sequence Strain (Species/Organism) : Mycobacterium avium subsp. paratuberculosis K-10
  • NCBI Gene ID : 2717869
  • NCBI Protein GI : 41407145
  • Locus Tag : MAP1047
  • Genbank Accession : AE016958
  • Protein Accession : NP_959981
  • Taxonomy ID : 262316
  • Gene Starting Position : 1095829
  • Gene Ending Position : 1098195
  • Gene Strand (Orientation) : +
  • Protein Name : RelA
  • Protein pI : 7.63
  • Protein Weight : 79917.73
  • Protein Length : 788
  • DNA Sequence : Show Sequence
    >gi|41406098:1095829-1098195 Mycobacterium avium subsp. paratuberculosis K-10, complete genome
    CGTGGCGGAGGAAAACAGCGCGGCGCAAGCGCTTGACGCGCCGGCGGAGTCGCCGCCCAACCCGGTGATC
    GAGACTCCCGAGCCGCCGACCGAATCGCTCAAGACGTCCAGCAGCGCGTCGCGCCGGGTCCGGGCCCGGC
    TGGCCCGGCGGATGACCGCCCAGCGCAGCACGCTCAACCCGGTGCTGGAGCCGCTGGTGGCGATGCACCG
    CGAGATCTACCCCAAGGCCAACGTGCAGCTGCTGCAGCGCGCATTCGAGGTCGCCGACCAGCGGCACGCC
    AGCCAGTTGCGCCACTCCGGCGACCCCTACATCACCCATCCGCTGGCCGTCGCCACCATCCTGGCCGAAT
    TGGGCATGGACACCACCACTTTGGTGGCCGCGCTGTTGCACGACACCGTCGAGGACACCGGCTACACCCT
    GGCCCAGCTGTCCGAGGAATTCGGCGAAGAGGTCGGTCATCTGGTCGACGGGGTGACCAAGCTGGACCGG
    GTGGTGCTGGGCAGCGCCGCCGAGGGCGAGACCATCCGCAAGATGATCACCGCGATGGCCCGCGACCCGC
    GGGTGCTGGTGATCAAGGTCGCCGACCGGCTGCACAACATGCGCACCATGCGGTTCCTGCCGCCGGAGAA
    GCAGGCCCGCAAGGCCCGCGAGACGCTGGAAGTCATTGCGCCCCTCGCCCATCGGCTGGGCATGGCCAGC
    GTCAAGTGGGAGTTGGAGGACCTGTCGTTCGCCATCCTGCATCCCAAGAAGTACGACGAGATCGTCCGGC
    TGGTCGCCGGCCGGGCCCCGTCGCGGGACACCTACCTGGCCAAGGTGCGGGCCGAGATCATCAACACGCT
    GAACGCGTCGAAGATCAAGGCGACGGTGGAGGGCCGGCCCAAGCACTACTGGTCGATCTACCAGAAGATG
    ATCGTCAAGGGCCGCGACTTCGACGACATCCACGACCTGGTCGGCATCCGCATCCTGTGCGACGAGATCC
    GGGACTGCTATGCCGCTGTGGGCGTGGTGCATTCGCTGTGGCAGCCGATGGCCGGGCGGTTCAAGGACTA
    CATCGCCCAGCCGCGCTACGGCGTCTACCAGTCGCTGCACACCACCGTCGTCGGGCCGGAGGGCAAGCCG
    CTGGAGGTGCAGATCCGCACCCGCGACATGCACCGCACCGCCGAGTACGGCATCGCCGCGCACTGGCGCT
    ACAAGGAAGCCAAGGGCCGCAACGGCGTTCCGCACCCGCACGCCGCCGCCGAGATCGACGACATGGCCTG
    GATGCGCCAGCTGCTCGACTGGCAGCGGGAAGCCGCCGACCCGGGCGAATTCCTCGAGTCGCTGCGCTAT
    GACCTTGCGGTACAAGAGATCTTCGTGTTCACCCCCAAGGGCGACGTGATCACCCTGCCCACCGGGTCGA
    CGCCGATCGACTTCGCCTATGCCGTGCACACCGAGGTCGGGCACCGCTGCATCGGCGCCCGGGTCAACGG
    CCGGCTGGTGGCGCTGGAACGCAAGCTGGAAAACGGGGAAGTCGTCGAGGTTTTCACCTCCAAGGCGGCC
    AACGCGGGCCCGTCGCGGGACTGGCAGCAGTTCGTGGTGTCGCCGCGGGCCAAGGCCAAGATCCGGCAGT
    GGTTCGCCAAGGAGCGGCGCGAGGAGGCCCTGGAGGCCGGCAAGGACGCGATGGCCCGCGAGGTGCGCCG
    CGGCGGACTTCCGTTGCAGCGCTTGGTCAATGCCGAATCCATGAGCGCGGTGGCCCGCGAACTGCACTAC
    GCCGACGTGTCGGCCCTCTACACCGCGATCGGTGAGGGGCATGTGTCGGCCCGGCACGTGGTGCAGCGGC
    TGCTGGCCGAGCTCGGCGGCATCGACCAGACCGAGGAGGACCTCGCCGAGCGGTCCACCCCGACCACCAT
    GCTGCGCCGCCCGCGCAGCAGCGACGACGTCGGCGTGTCGGTGCCCGGCGCCCCGGGCGTGCTGACCAAG
    CTGGCCAAATGCTGCACGCCGGTGCCTGGGGACCAGATCATGGGATTCGTCACCCGCGGCGGCGGGGTGA
    GCGTGCACCGCACCGACTGCACCAACGCCGCCTCGCTGCAGCAGCAGTCCGAGCGCATCATCGAGGTGCA
    CTGGGCGCCGTCGCCGTCGTCGGTGTTCCTGGTGGCCATTCAGGTCGAGGCGCTCGACCGGCACCGGCTG
    TTGTCCGACGTCACCCGGGTGCTGGCCGACGAGAAGGTCAACATCCTGTCCGCGTCGGTCACCACCTCCG
    GTGACCGGGTTGCCATCAGCCGCTTCACCTTTGAGATGGGCGACCCCAAGCACCTCGGCCACCTGCTCAA
    CGTGGTGCGCAACGTCGAAGGCGTCTACGACGTCTACCGGGTGACCTCCGCCGCCTG
  • Protein Sequence : Show Sequence
    >gi|41407145|ref|NP_959981.1| RelA [Mycobacterium avium subsp. paratuberculosis K-10]
    MAEENSAAQALDAPAESPPNPVIETPEPPTESLKTSSSASRRVRARLARRMTAQRSTLNPVLEPLVAMHR
    EIYPKANVQLLQRAFEVADQRHASQLRHSGDPYITHPLAVATILAELGMDTTTLVAALLHDTVEDTGYTL
    AQLSEEFGEEVGHLVDGVTKLDRVVLGSAAEGETIRKMITAMARDPRVLVIKVADRLHNMRTMRFLPPEK
    QARKARETLEVIAPLAHRLGMASVKWELEDLSFAILHPKKYDEIVRLVAGRAPSRDTYLAKVRAEIINTL
    NASKIKATVEGRPKHYWSIYQKMIVKGRDFDDIHDLVGIRILCDEIRDCYAAVGVVHSLWQPMAGRFKDY
    IAQPRYGVYQSLHTTVVGPEGKPLEVQIRTRDMHRTAEYGIAAHWRYKEAKGRNGVPHPHAAAEIDDMAW
    MRQLLDWQREAADPGEFLESLRYDLAVQEIFVFTPKGDVITLPTGSTPIDFAYAVHTEVGHRCIGARVNG
    RLVALERKLENGEVVEVFTSKAANAGPSRDWQQFVVSPRAKAKIRQWFAKERREEALEAGKDAMAREVRR
    GGLPLQRLVNAESMSAVARELHYADVSALYTAIGEGHVSARHVVQRLLAELGGIDQTEEDLAERSTPTTM
    LRRPRSSDDVGVSVPGAPGVLTKLAKCCTPVPGDQIMGFVTRGGGVSVHRTDCTNAASLQQQSERIIEVH
    WAPSPSSVFLVAIQVEALDRHRLLSDVTRVLADEKVNILSASVTTSGDRVAISRFTFEMGDPKHLGHLLN
    VVRNVEGVYDVYRVTSAA
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A M. avium relA mutant is attenuated in calves and goats. This mutant also elicited an immune response in goats that limited colonization by challenge wild type M. avium (Park et al., 2011).
  • Related Vaccine(s): Mycobacterium avium relA mutant vaccine
1. FOXP3
  • Gene Name : FOXP3
  • Sequence Strain (Species/Organism) : Bos taurus
  • NCBI Gene ID : 506053
  • NCBI Protein GI : 114052154
  • Locus Tag : BOS_25920
  • Genbank Accession : GJ063427
  • Protein Accession : NP_001039398
  • Taxonomy ID : 9913
  • Chromosome No : X
  • Gene Starting Position : 92369103
  • Gene Ending Position : 92375460
  • Gene Strand (Orientation) : -
  • Protein Name : forkhead box P3
  • Protein pI : 10.15
  • Protein Weight : 45036.21
  • Protein Length : 431
  • DNA Sequence : Show Sequence
    >gi|258513337:92369103-92375460 Bos taurus breed Hereford chromosome X, Bos_taurus_UMD_3.1, whole genome shotgun sequence
    CACCTTACTTCTTGGTCCCTGCGGGCATGTCCAGGGCTGGTCACCCCTGCCCCCAGCCACTTCGATCCCC
    TCCCCTGTCCTCCCTTCTCTTCTTGGCTCTGAGATCAGGGGCCAGGTGTGGGGTTGGAACACCTGCTGGG
    CCTCTGGCTCCTCTTCTTGCGGAACTCAAACTCATCCACGGTCCACACAGCCCCCTTCTCGCTCTCCACG
    CGTACGAAGCACTTGTGCAGGCTCAGGTTGTGGCGGATGGCATTCTGTGCAAGGAGGACCAGCCAGCCGG
    GCCAGGGCCAGGGGGTGGGGGGATCAGGCAGCCATGCACTGATGCCAGCAGTGCCCACCCCAAACTGACC
    TCCTGCCCTTTCCCAACACGCCTCCAAGCCCCCTCCCAGGCCCACCTGTGGTGGCATTTGAGGCCCTCCC
    AGCCACTGCCCCGTCCAAAGAAGCTCACCTTCCAGGTGGCTGGGTGGTTTCTGAAGAAGGCAAACATGCG
    TGTAAACCAGTGATAGATCTCGTTGAGTGTCCGCTGCTTCTCAGGAGCCTCCAGGATGGCCTGGAGGTTA
    GGGAGTGTGGGGGTGAGGGGAGCTGCTCCCCCAAATGCAGCCTGACAGGGGCACTGGCCCACCTTGGGCT
    GGCCTCTGACCTGGGTGGAATTGTGGGGACAGGGGAAGGGAGGGAGATAGTGAGGGGTGACGGGTCAGAG
    ACAGGGTTAGAAGTGGGGTGAGGGTGGGGCTGGGATGGGGTTAGGTGAAGGATCAGGGCTGAGGTTGGAG
    TTGCTTCTGGTTCAGGGTCAGGGCTGGAGTGAAGTTAAATTTCTGGGGTGGAGTTGGAGCTCTTGGGATG
    GGGGTAGGGTGAGATTTCAGGGTTTAGGAAGTTTAAGGGCCAGGGGTGGGGTACAGTTAGGGTTTGGAAG
    GAGTAAAGGGCCCAGCAGAGTTAGAGGTCAGATAAGTGACTGGTTAAGGGTCAGGCTGGGGATGAGGTGG
    GGTGAGTCAAGGGGTGAGGGGTGGGATGACGTGTAGCATTAGGTCAGGAGGCAGAGATGGGCCTAGTTAT
    TTTGTGTGTCTGGACTGTAGTTAGGTCTTGACTGTGTGTGGTCATTTAAGGATCAGGGATGGGATTGGGT
    GTGGAGTGAGGCTGAGGGTCTGGGAATTTGATCTGCTGGGATTTAGGAATGGAATTGCGTCAGGGGTCGG
    TGATCATGGCTGCAGTGAGCCTCCGGGTTTGGATGGGGTGAGGCAGGTGAATGAGTGGTGTTGTGTAGGG
    TTAGGTGTGGGCCTGGGATGAAGGTCCATGTGGGATCTGGTGAAGCTTTGGGGAAGGCATTAGGGAGATT
    AAGATGAAGGGGTTGGGATGGGGTGAGGTGGGAAGGGGTTAGGGGTGGGGTCTAGCAGGGGGATGTCTTG
    ACAGACTAGGGTACGTCAGGGCTGAGGAAGGAGTTAGGGTGAACCTGAGGTGGGCATAGGGGAAGGGGCA
    GAGATCAGATTAGTTTGGGGGCTATTTATAGGCCCAGGAGGCAGTTAGGCATGGGGTTGAGGTGGTCGTT
    AGGAAAGGGGTGGATTTAGGGCCGGCTCTTGGCTTGCCATGGCTTGGACAGCAGTTGAGGTGTGGGTTTG
    GGGTGTAGATGGGGAATCACATCTAAGGCATGGGTTTGTTCACACAGGAGGCCCCCTGAGGGTGTTTGGT
    GAGGGGAAGGTCCTCCACCCCAGCCCTCTCTTCCTTCTCCTCAGCCTGGCACCCCGCTTACCCAGCGGAT
    GAGGGTGGCATAGGTGAAAGGGGGCCGCATGTTGTGGAACTTGAAGTAGTCCATGTTGTGGAAGAACTCT
    GCAAGAGGTGGGGAGGGATCAGGGGCCATCTGGGAACTCCTCACTCCCTCTTCCACCCTCTGCTCTCCAC
    CAGCTGTCGAGTCTGCATGCCTGAAATCCCACCGTGTACACCGCTTTCCAGGATCACAATCACTGTTGGC
    TAAGCACTCTACGTAAATGATACCATTTCCTCTTTACACTGCTCCCACCACTATAGGGCTTATTCTTCCC
    AAGGTTTAAAAGTAGTAACTTCCACACCAAAGGGATGTAACTGGTTAAGTGGCGGGGCCAGGAGGGCACT
    CAAAGGCCCTGATCCCTGTTAAACCCATAGCCCAGACCTTGTGGATGGCAGAGGATTGGGGAGCTCAGCA
    AGTCACCCTGCTTTTTCTTGGTGGTGGGGAGACAAAGAGTCCCTGGGAATTATTAAGCTAGCTCTCTCCC
    TCCTGATGACCAAATAGAGTGAGTGGCTGAAGCTCAGAGTGAGTGAGTCCCAACCTCCAGGGAAGACAGG
    GCTAGACATCTGAGACCACAATGGGGGCTTGGAGGCCATGGAATTCCAGAGAGGAAGCTTTTGCAAGCAG
    TTGCCATTTCCCAAAGGCTGGGTGGCAGTGGCAGGGGAGAGTGGTCCCCAACCTTGTACCAGTTAGGGAG
    ATGAGGGGTCAGGGGGCACCGTGTAGGACATGCACCACCCTTACCTGGGAATGTGCTGTTTCCATGGCTG
    CCCCAGAGGTGCCTCCGCACAGCAAACAGGCCATCGGGGGCCTCCTGGGGTCCTGGCCAGGCTGGGACGG
    TGGTGCCTGGGGTGCCAGTGGCTACGATACAGCAGGAGCCCTTGTCAGATGATGCCTGGGGGAAGAGGGA
    GGGGCTGGTGACCCAGAGGCTTAAACTTTCCACTTTAGTTTTAAATAAATGTTTTTATTAACAAAAGCAA
    GGGCGTCCTCAATTCCACTCTGATGTGGAATCCGACGAAGCAGCACAAACCATATTTATTAGAGTGGAGG
    TGTGGACAAATGGGTGTAGAGCACCAGTGATGGGGCCACAAGCTAGGGTTGAATTGGAATTGGGCTCTTC
    TGCCACCCAACTGGGACCTTGAGGAAGTCACCTAAGCCTCCCTGGCCTCAATTTTCCTCAACTGTGAAGT
    AGAGATGATAGTAATACCTCACACAGGCATCATGAGGAATTAAATAAGGTAACATCACCAAAGTGCTCAG
    AAACAATGCCTGACACCCAGGGCTGGCTATATGATCACTGCAGGTGCCCAGGGCCCGGCACTTTGTTTAA
    TGTTCTGCAATCATCACTTTGAAATCCGAGCCCTGTGATTTCATTTTGCACCAGGCCCTGTGAGTTATAT
    AGGTGGTTCTGCCAGCAGCACGTGGTCTGTGTTCAGTGTTGGGTGATTTGCTGTTGCTTTGCAAACTCAA
    GATCGTGATGTCTGGGGATCTTAAGATCAGAGAGTTTGTAAGCAGAAAGTGACAGATTCCCAGGTCTGGA
    TGTGTTTGGAGCTGGGGACAGGGGCCCAGAGATCCCAGGACCTGGGTGCAAGGATAGGTCCCTTGCACCC
    TGCAGGAGCCTCTCCCACTGCCCAGCCGTCCGTGCCACCTGTGGGGTCTGGGGTGGCTCACCGCAGATGG
    AGCCTTGGTTTGGGCCATCTTCCCGGCCAGATGGGCCTGCATAGCACCCAGCTTCTCCTTCTCCAGCACC
    AGCTGTGAGGACAGGCACAGAGTGAGGCCTCGACCCACTCTTTCTCTTCCACTTATTTGCCCGGGCTGTG
    GTCTTCCCTGGGAGTGCCCTGCCCCCTTCCTTCCTTCAGGCCAGGCCCCTTCCTGGGTGAGCTTGGCTCC
    TGGCATGGGGTGGACTGACCATTTACCACACCCCCACATCACCTGTTGCTCCAGAGATTGCACCACCTCC
    CTCTGGAGCAGACACTGCGCCCTGCCCTTCTCATCCAGGAGATGGTCTGCCTGGCAGTGCCTGGGTAGGG
    GGAAGAGTCCATGCAGGTGACCATGGTGGGACAAGCCTTCTGGCTCAACATTCTGAGGGGAAAGGGCTCA
    GACTCTCTGGGAGGAAGGTCTCTTCAGAGTCTCAGCCTCCCTCCCCTCTTTTGACCTCAGTCTCCCTCTC
    ACACCTGTCATTCCTTCAATGCATGCCACTTGGCATCTACTCTATGGCCAGGGTGCTGGAGATGATGATG
    GATGGGTAGTGAGCTGAGAGCGGGCCAGGTAAGTGAGAGTGGGAAAGGCATTCCAGATGGAGAGGACCGC
    CTGTCCAAAGGCCTGGTTGTGAAGACAGGATGCACTGAGTTGCCACTGATAGTTGGGTATGGTTGGAGAA
    GGGGGTGGGTGTGAGACAGAGAGAGAGAAACAGAGTGTGTATGTGTGTGTGTGTGTGATGGGGCTGAGAG
    GAGGCAGCAACAGCCACTGTGAGGATCTGGGACTTCAGGGATCAATAAAATCAGGCTGGTGTGTTGGCAT
    GACAGGGTAGCAGGGCAAAGCAGTTAGGAGTGTGGATTCTGGAGGCTGGCTATCACTCAGAAGCTGGGTG
    ATCTTGATCAAGACACAACCTCGCTGGCCTCAATTTCTTCATCTGTAAAATGGAGGCAATCAGCACACAC
    CTCTATTGTGATGCCCCATTATACAGATGAGGAAACTGAGGCTCAGAGAAACTAAGTAATTTGCCCAAGA
    TCAGAGCCCATGAGTGATGGAGTCAGGCTCTGAACCCACAGTCTCAGCTTTTGCCTCTTTCATCTTACTC
    CCTATCAGGATGAGGCGTGAGCTGAAACCTGCACCCCCAGACCTCCCACAAACTGACCCCCACCCCTGGA
    CCAGAATGGGCCTGGTGGGCCCAGCTCACTCACTTGAGGAAGTCTTCTGGCTCCTTGAAGACCTTCTCAC
    ATCCGGGCCACTTGCAGACGCCATTTGCTAGCAGTGAGTAGGAGCCCTGGGGCACAGTCGAAAGGGTGCT
    AGGGGGGACAAAGAGTGTCAGGGGCGGGTGTGGCAGGGCAGGGAGCCTTCCCAGCCCTGTGCACTGACCT
    GTCTTTCCTAGGCATGCCGGGGCTTGGGAAGGTGCAGAGCAGTGCTGGCTCCCTGGAAACCCACTCCAGG
    CTGGCCACGTTGATTCCTGCAGGGGGGACAGGGCACCTCTGGGTGCCAGGCTCTGAAGCTTGGCCCCGAC
    CAGGCCTCTCGTTTTGAGCTTCCGACCCCCCCCTGAGTTTAGCAGGCCCAGACTCCCAGGGGGCTCTGTG
    GTCCCTAACCTCCAAAGCTTCTGTAGAACAGCTCAAAGACTGTGCTGACATTTCGACTAACTGCAAAAGA
    TCTGTGGTTCTGGGATTTTGACATTCTGCGTCTTTAAGATTCTGACATTTTTGAGAGGTTGGAGTTTCCA
    AGATGATAAGACCTGACCCCTCTGGCCCCCCGAGGGCCGTGATTCAGCAGCCCACACTGCTTTAGTTCAA
    GGATTGGGGGCTCTGGGGTTCTGTGGAACTGTGGGGTACAGTGTTACCAGGTGGCAGGCCGGGCCGGGCC
    TTGAGAGAGAAGAGCCCCGTAGCAGCAGTGGGTGGCGGGAGGCTGATCATAGCTGGGCTGTCCAGTGGGC
    GCACCTGCAGCACAGGGGTCCGGGCATGGGCGTCCACCGTTGAGAGCTGGGGGCACATGAGGGCTGTGGT
    TCAACCTGGTCCCCTCCCCAGTTCTCCCGCCTGCTCCACCCTCCCTACCCGTGCTGAGCTGGTACCTGGT
    GCACGAAGTGTGGCCTGTCCTGGAGGAGCGCCTGCAAGTGGGGCGAGGGACCCAGCCGAGCTCCGGAGGG
    TGCCACCATGACAAGGGGTACTGTGGGCATCTGGGGGAAGGCAGGTGGGTGACATGCTATCCTTATGCTC
    ATTCTACATGTCTAATCCCTATACTCCTCACTACAACCCTGCCTACTGGATACTATGACCATCTCCATTT
    TACATATGTGGAAACTGAGGCTAAGGGAGACTGGGTGACTGTTTCAAGGTCAAGCCAGCTAGTAAGTTTC
    GGAGCTGGCTTCCATCCCGTCACCTTACCTCTGTGGGCCCCCAGCCCTTTGTCAAATGGGGGTGGAGACA
    CACACGGCTATGCCTATGGGACGATGATGGGGTCTCCTCTCCTGAGATATGGGTTGGGAGGTTGGTGAGA
    GCCTCGAATCTCTGAGACCTGCTATGTGGGGACTTTCTTGGCCCTGTGACATCTGCATAAGTCACAGACT
    TGCCTGGGACCCAGAAAACCACTTCCTGTGCCCCAGCTGGGCCCCCCCTCCCAGTGCCACAGTAAAGGTC
    GGCACCTGTAGGCCCAGGTGCCCCACCCTGCCTGCCCTATCCTGGACCCTAGGCCTTACCTGCAGCTGTG
    ATGGTGGCATGGGGTTCAAGGAGGAAGAGGAAGTGTGGGCCCCGCTTCGGAGATCCCGGCCTTGGAAAGT
    TGTCCCTGGGCTCTTGGTGCCCAGCTGGTCTGAGGCCTTGGGTGCAGCCCTCCAGCTGGGCGAGGCTCCT
    GGGGATGGGCTGAGTACCAAGGAAGGGGCCAAGGGCTTGGCTGGCCTGGGGTTGGGCA
  • Protein Sequence : Show Sequence
    >gi|114052154|ref|NP_001039398.1| forkhead box protein P3 [Bos taurus]
    MPNPRPAKPLAPSLVLSPSPGASPSWRAAPKASDQLGTKSPGTTFQGRDLRSGAHTSSSSLNPMPPSQLQ
    MPTVPLVMVAPSGARLGPSPHLQALLQDRPHFVHQLSTVDAHARTPVLQVRPLDSPAMISLPPPTAATGL
    FSLKARPGLPPGINVASLEWVSREPALLCTFPSPGMPRKDSTLSTVPQGSYSLLANGVCKWPGCEKVFKE
    PEDFLKHCQADHLLDEKGRAQCLLQREVVQSLEQQLVLEKEKLGAMQAHLAGKMAQTKAPSAASSDKGSC
    CIVATGTPGTTVPAWPGPQEAPDGLFAVRRHLWGSHGNSTFPEFFHNMDYFKFHNMRPPFTYATLIRWAI
    LEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGVVWTVDEFEFRKKRSQR
    PSRCSNPTPGP
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): Mycobacterium avium relA mutant vaccine
2. IFNG
  • Gene Name : IFNG
  • Sequence Strain (Species/Organism) : Bos taurus
  • NCBI Gene ID : 281237
  • NCBI Protein GI : 31982949
  • Locus Tag : BOS_5228
  • Genbank Accession : AF140653
  • Protein Accession : NP_776511
  • Taxonomy ID : 9913
  • Chromosome No : 5
  • Gene Starting Position : 45830157
  • Gene Ending Position : 45834980
  • Gene Strand (Orientation) : +
  • Protein Name : interferon, gamma
  • Protein pI : 10.24
  • Protein Weight : 18866.5
  • Protein Length : 166
  • DNA Sequence : Show Sequence
    >gi|258513362:45830157-45834980 Bos taurus breed Hereford chromosome 5, Bos_taurus_UMD_3.1, whole genome shotgun sequence
    AATTAGAAAAGAAAGATCAGCTACCTCCTTGGGACCTGATCATAACACAGGAGCTACCGATTTCAACTAC
    TCCGGCCTAACTCTCTCCTAAACAATGAAATATACAAGCTATTTCTTAGCTTTACTGCTCTGTGGGCTTT
    TGGGTTTTTCTGGTTCTTATGGCCAGGGCCAATTTTTTAGAGAAATAGAAAACTTAAAGGAGTATTTTGT
    AAGTATGATCTTTTAATGAGACTTTCTTGTGATTGAAATGACTTGATGTTTGATGTTGACTTGGAATTCT
    ATCTATGATGGGCTCTCATCTCTAGTCTTCAGTCATTTTGAGAAGACTTGCTGTTATTGTGACTGTTAGC
    TAGATGTGTTTGTTTGTTTGGTTTTTTTTTTTTTTCTGACTAAACAATCTCTGCTCAGTTTGCTATAGAG
    ATTTAGAAGGGATTCATGAATCTTTCAAAAGATGGGCATAATATGTGTATACATCATAGTGTTGATATTT
    TGTGATAAGAATCCATTCAACTATGATGTTAAGTAGCAAGCATACTGAAAAGACAGCTGAGTCTTAATTT
    TTGATTTCTCATGTTACTATAATGATGACAGTCAGAAGTCAAGATCAGCATTAAAAATGGTCATTTGACA
    TAATTGATCAATTAAAGAAGATGAGGTCCTTAAATATTTGGCTTAAAAACAAAAACACTTATAGGTGTTT
    TTCTCTAAAAAGTCATTTTAAAATTTTACTATCCCATCTAGATTGTCTGTGAATTACTCTTGGACTCAGT
    CACTTGCTGAGATTTTTTTTGTAGGAGTTATAATCTAGTTTATATTTTAAAAAATTTTTTGTCTTGTTTT
    AGGAATTTCTTAAAAATTTACTTATGGTTAATTAAAATAGCTTGGGCATTTTAAATATTTTATCATATAT
    CCAAATTTAGCTGTTATAATTATAGCTGGAGCTATCTTTTAAAGGCGATATAATACCTTATAGGAGGACA
    CAGGTAGAGGTTATGAACCGTATACCATAGGGGGGCAGTATTTTATAGTGAGATGATGTTGTTGATTTTT
    TTTTTTTTTTTAACTATACCTTTTTCTTACCATAGTAATTTGGGACAGTTGAAGTATCATCAGTCTTGAA
    TGAGTTCATTGTGATGTTATATTAGTAAATAAGAAAGCAAAAATCACATGATAGTCTTTGGCTGTTATCC
    AACCAGGTAGCTTTTGTGAATATTTTTTGTTAAAACTAAACAGTGTTGAAAAGAAAATCAGTAAATAGTG
    CCAGCATCCAAGTTCAATAAAACTTGAGGTACATTTTTACAGCAATTTATGGACTAATTTTAAGCCAATT
    TTTTATTGTGTTGTTTTATTTTCCAGAATGCAAGTAGCCCAGATGTAGCTAAGGGTGGGCCTCTCTTCTC
    AGAAATTTTGAAGAATTGGAAAGATGTAAGCTGAACATTTCCATTTGGCTGATTTTCCTGTTGCTTTTTT
    TCTGATGGATAAATTCACATCAACCTCTCTTTGTGCTCTTTTCTCCCAAGGAAAGTGACAAAAAAATTAT
    TCAGAGCCAAATTGTCTCCTTCTACTTCAAACTCTTTGAAAACCTCAAAGATAACCAGGTCATTCAAAGG
    AGCATGGATATCATCAAGCAAGACATGTTTCAGAAGTTCTTGAATGGCAGCTCTGAGAAACTGGAGGACT
    TCAAAAAGCTGATTCAAATTCCGGTGAGATGATCTTAATGCTTTCTTTGGTATCATTGCAGAGGCTCTTA
    CAAAGCACTTCATTCCCAGAAAATAGAAATTAGATACCAGGTGTAAAGCTCTGAAGTGAACTTGTGGTCA
    AAATGCCTCTTTGCTAGTTCTCTTTTGACTTGGGTGACTTTGCCGAGTCAGTTATTGGAGGCACTTAAGT
    CTGTGATTTTGGGAAAATACTGGCATTATGCCTATCGCACAAAGATGGGTGAATGGACAAATCAGTGAGG
    AGGAAGCAGAGAAGGAGTTGGGGTGATGGGGACAGAGTACTGAAAACCAGTTCTCCCATTGCCCCTTGTC
    TGTGTGTTGGAAATTCTCTTGCTTTGAATAGGTTGCATGTCTTAATGGAAAGAGCAGTGGGAGGGAAAGG
    GAAGAAGATGTGTGCTCCGCCCAGCTTAGCCACCAAAGAAATGTGTGACTTCAGATGAATCACAGGCCTG
    GCTGGGGCTGTTTCCTCATCTTAAAAGGAGCCTGTTGAGTTCACTGTAATTTCTACGGTCTCCTTTGCTC
    TAAAATTCTACAATGCCATGGAAAGAAAATGAGAATGAGATAGGAGAAAGGAATAGCCTTTGAGGAGACA
    AAGGCCCTCCCACTGTCGAACTCTGGTCAATCACCCAGATTGTATAGCCCAAGGAGAGGTGACTGCGTTT
    GTTTTTAGAAAGAAAATAGGTAGAATTGTCCTATCAATGAATTTTTAAAGTTTTTAGAAGCTGAAAGATC
    ACTTTGAAGCATAAGGACAAGTCACATTTTCCAAAATTTCACCTAAGGGACAACGGTCTCCAGATTTTTT
    TGCGGGGGAGAGTTGGCTTTTGTATAAATAGGCTTGGGTGAGAAGAGGAGGGGTCCCATTATGACTTGTG
    CTTTCAGGATTTGTACCAGCTCTTGCTCTAACCTGGTCTGCCTCTCAACAATCTCATATAAGCTCCCAGG
    AACTGAAATAAGTGGTTGCTCTTCAAGATTTCTCTAGTCTCCCATATATTAGATGGTATGAGAGTGGCTT
    GGAAAAATTATATGTAATGTTTTCCATGTTCAGCAGATCTCCATTGGTTGCAGGCTAGAGAATGAAAAGG
    CACTGTTCCTGACCCAGTGCTGCCTCTGGTTGCTGTTCAGTCCTAGAGAAGTCCCTTAGTTTCTTGGTGA
    TGCTTAGAAAACTGGAAAGTTATCACTTGTAAACACACAGCTGGTAGAAATTTTTCTACTCTGTTGTAAC
    TGGGCCTTGAAAACAATAGGTTGGTCCCATCCTTCTGGAAGCTCCAAGCCTCCTTCTTCACAATGTGCAA
    TCTTGAGTGAGTGCTCAACCATTGTCGTCTTTTGCTCAAATGTGAACATATTTAAGGCACGTTTTGCCTT
    TTTGTCTTGTAACTTAGAATCTCCTAGTCATTCTCAGAAATGTGGCAAGGTGGCTGCAGTGTTTCAGCTT
    TAGAAAGAAATGTAGTGGCAGAGCAAAGATGAAAGCAAATGGTCCTCATTTTATGAAGCATGAATTCACC
    TATATTGTCCTACTGGGAAGAGTGAGAAAATAGTTCAATTTGCTGGAGTGGAAGGCAGGGTACCGGGAGA
    TTGCTTTCATTTCTAACTTTATTATATAATACCAGTAATTGATTACTACCTTTAAATAAGATCCGTGTTT
    ATTTTTAATCCCATCATGGAAACAATGAGACTGACCTAATTTGGAGGAAATTAAAAATAATGGTTTTCCT
    CCTTCTAGAACTTGGTGTTTATAAAGTACTGAACCTATACCAATGGTTTTCAAACTTGGGTGGTGCCTAA
    ATCACCTGGTGATGTTGGTAACCACACAATGGCCCAGGCCTAGTCCGATTTCACCCATCTGGGTGTCAGA
    GTTCTTCATTAGGTCCTCAGGTTACTCTTTTACGCACCAAACATGAGAGCCATTGGCTATAGTAACTCAT
    TTGATGCTTACAGCGAAGACTAAGTACTAAGTGATAGCAGTGACGGAGACCCTAGGGATCATCTAAACAC
    TCTCCTCATACTTAGTGGAGAAAACAGAGATCTGGAGAGCCTCAGTGACTGGTTTAAAGTCAGATGTATT
    GCACACACAGAATTCACACCCACATTTTTCTGTCACTCTACTTCTGGGGTTTTTTCACTATATAATTTTC
    AGATCTCTGAAGTGGTAAATTTATGAATATGTGATGTGCTCCATCCTGTTACAGTACAACTATCAATTGA
    ATTGTTATAATTTTAGTTTTTATCACTGAAGAAACCAACATTACATATTAAGGTTCATTACTGCTAGTGA
    AAATAATTTGTTTTAAAGAATACTTTGATTTTCTTGGGCCTAGACAGCAGAATATCCTAATGACTCATAG
    GCCTGAAATTAATTTTGCTGTTTTCTTTCCCAATAGGTGGATGATCTGCAGATCCAGCGCAAAGCCATAA
    ATGAACTCATCAAAGTGATGAATGACCTGTCACCAAAATCTAACCTCAGAAAGCGGAAGAGAAGTCAGAA
    TCTCTTTCGAGGCCGGAGAGCATCAATGTAATGGTCCTCCTGCCTGCAATATTTGAATTTTTAAATCTAA
    ATCTATTTATTAATATTTAATATTTTACATTATTTATATGGGGGATATATATTTAGACATCAAAGTATTT
    ATAATAGTAACTTTTATGTCATGAAAATGAGTATCTATTAATATATGTGTTATTTATAATTCCTGTATCC
    TGTGACTATTTCACTTGACCCTTTTTTTTCTGAGTAACTAGGCAAGTCTATGGGATTTCAAGGTTTTATC
    TCAGGGGCCAACTAGGCAGCTAACCTAAGCAAGAATCTGTGGGTTGTGCACTTATTTCACTTGATGATGT
    AATGAATGCTGATAAATGAAATGATGCCATCTAGTCACTACTTATCTGAGACTAGATCTGGATTCTGAGC
    CACTACTTTGATGGCATGTCAGACAGCACTTGAATGTGTCAGGCTATATGACTTGTGCCCTGACAAAAAC
    ATAGCATCTCATCTCACCTTATACCTGGCGCTTCAGGATATCACTGACAATTGTGATTACACCCAAATGG
    AAAGTAATATGTTTGTTTAGTTTATCAATATTTAATATATATGAATAAAGTATAATTTCATAAC
  • Protein Sequence : Show Sequence
    >gi|31982949|ref|NP_776511.1| interferon gamma precursor [Bos taurus]
    MKYTSYFLALLLCGLLGFSGSYGQGQFFREIENLKEYFNASSPDVAKGGPLFSEILKNWKDESDKKIIQS
    QIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQIPVDDLQIQRKAINELIKVM
    NDLSPKSNLRKRKRSQNLFRGRRAST
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): Mycobacterium avium relA mutant vaccine
3. IL10
  • Gene Name : IL10
  • Sequence Strain (Species/Organism) : Bos taurus
  • NCBI Gene ID : 281246
  • NCBI Protein GI : 41386772
  • Locus Tag : BOS_15514
  • Genbank Accession : GJ062448
  • Protein Accession : NP_776513
  • Taxonomy ID : 9913
  • Chromosome No : 16
  • Gene Starting Position : 4402473
  • Gene Ending Position : 4406411
  • Gene Strand (Orientation) : -
  • Protein Name : interleukin 10
  • Protein pI : 8.14
  • Protein Weight : 19616.38
  • Protein Length : 178
  • DNA Sequence : Show Sequence
    >gi|258513351:4402473-4406411 Bos taurus breed Hereford chromosome 16, Bos_taurus_UMD_3.1, whole genome shotgun sequence
    AAATAGCTCACAGAGAAGCTCAGTAAATAAATATATGTGGGAGCTGAGGTATCAGAGGTAATAAATACTC
    TAGGGGAGAGGCACAGTACAGGTCTCCAGGGAGCTGGCTCTGCTCTCCCAGAACCCTGGATTGGATTTCA
    GAGGTCTTCCGTTTACGTCATGGAGTCTAGTAGAGTCACCATCCTGGAGGTCTTCTTCCCTAGAATGCTT
    CACTTTTGCATCTTCGTTGTCATGTAGGTTTCTATGTAGTTGATGAAGATGTCAAACTCACTCATGGCTT
    TGTAGACACCCCTCTCTTGGAGCTGTGTGGGGAGACAAGACGTGTTCAGTGAAAACTCCCTCTGAGCAAG
    TGAGTGGGTCCCTGCTGGGAAGGTCATGACCCTGGGCCCAGAGGCTGCACTAGCTTGCTTGCATTGGGAG
    ATGAAGGACAGACTCTGGGCATCTGGAGAGATGCCGGACTGTCAGCAAAGGCTATGCGTTGCCCTGGACC
    TTGCCCGGTGGGCAGCAAGAGGAACATTCACTTTGCAAAGTGTGGTTTTTCGAACGGTGCTTTTCCAGCA
    ATTTTAAACGTCATGTGCTCACGTGACGCTTATTCAATATCTGATGAAAACACATTAGCGGAACCACTTT
    GAAAGAAAGACAATGAGAGAGAGAGAGAGAGGTAGCCTTGTTCCTGTTTATGTTCCCCCACCCGTGGAGT
    GAGCAGGCCCAGCCCCGCTGCTCTGACCTACTGCAGGGAGGTTCATGGCCCCTGATACTGGAACCTGCCC
    AGGGTCTGTCCCCCACCCACGAGGAGGACATAGGTTCCGCGGCTTCTGGAAAATGGGGTAGAAGAGCTCA
    TGGACAGCTGGAAGTGAGAAAGGCCACTTCGTTTGAGAGCTGAGATTCTCAGGTGCCTTGTGTGGTGAGG
    CTGGCGGGTGGAAAGAGAGGGGTCAAGTCAGGTAAGGAGAGCTCTGCTTCCTGCTCTGGGCTCGGGGTGC
    TCAGGCTGCGCCCCTGGGTGTGTTTGTAAGTGCACGTTCACGTGTCAGCTTCCTGCACGTGCGGCTTCAG
    ACTGGATCCCAACAAGCTACTTTCTGTTTCCTCTGTCACTCTCCCCAGCACCCCGCTCGCTGTGTTCACA
    GCTGGCGGGCCAGCCCAACCGGCAGGCCTGCGAAGGCAGGGAGCAGTCATTTAGAAACCCCCAAAGACAC
    TTCACAGAAAACAAATATAACTGAGGTGGCGGCCCCTCACTGGATGAAGAGGTCACCCCACTTGCCGGGT
    TCCCACACTCCCTCCGAGCAAAGTTCAGGGCCTGCTGAGCACCTGCCCACCTCTGCCCCTTCGAGAGTGG
    ATGGAGGTCACGGTCCTCAGGCCCTCCCTGCCAGCAGCCCAGCCTCACCTCACTGAAGACTCTCTTCACC
    TTCTCCACCGCCTTGCTCTTGTTTTCGCAGGGCAGAAAGCGATGCTGTGGAAAAGGAGAGAGTATGAGCA
    ACATTGGTGGCTGGTCCCAGATGCACCGTGCTTGGGAGACAGCCTGGGAGCAGGAGGAGGCCAGCTCATC
    TTGAAGGCCCACCCTGCATCTCAGGGAGGACTGAGCCTGGGCACCCTTCCCCACCAGGCAGAGAGGAAGC
    ACAGCAAGGCAGGGGCCAGGCGGCATGTGTGTCTCTAGGAGCTCCTCCCCACCGTTAACAAGGCTGCATC
    AACACCTCTGTCTTGGAGTTTCCTTCCGGGCGCATCCCAGTGCCAACCAGACTGCTGAGCCAGCCCTTCT
    TCCATCCTGTCCTGCTTCTGGCCTGTCCCCCTCCTTGGTCCCAGCCACAAGGACCATTTCTAAGTGCCCC
    GCAGAGCAGAGACACAGGGTCAGCCCTGCCAGCCAACCCCCTTGCCTAGCGCTGTCCTGCAAATACAGCC
    CAACTGATTTCTCAACATCGGCGAGGGAGCAGAGGAAACTGGTGGGGAGGGTATCATTGCAGTTGGAGGG
    ATCAGTAATCCTGGGGGATTATTCGCAGACACTAGCCTGGGACCAAGGATCCCCCTGGCTCTTCTAAAAT
    GCCAGGACAGTCCTGGCAGTCAGCCGGGCCCCACCTGAAGCTCTGCTTTCAAAAGGTCGAGAAGAAGAGG
    AAGGGGCCTTCCCTCTCCCAGGCCCTCTGCTTCTGCCTGCTTCCGTGGGGCCCAGGGCCTCTGTCCCCAG
    GGACAAGGGAGCCCTGGCTGAAGCTCTGGGCCCCTTTCACGTCGAGGCCGGGGACTGCTAATAACCCACA
    AATGACTCACAAATAACAGGAAAGCTATTGCAAATCTTCACATGTAAGCACTCAGCAACCACCCCCACCC
    GCGGCTCAGAAACAGCCGAGCCAGGCCTGGGGTTCCGGAGGGGCAGGGGCCCCGAGGGCTGGTGTCCCGG
    GGTCTCTGGGCGAGAGCAGAGCTTGAAGAGGAGGTCTCAGCACGAGCCCAGAGGAGCCAGAGCTGGCCTG
    CTACTCACACAGCGCCGCAGCCGCAGCCGGAGGGTCTTCAGCTTCTCCCCCAGTGAGTTCACGTGTTCCT
    TGATGTCAGGCCCGTGGTTCTCAGCCTGTGGCATCACCTCTTCCAGGTAAAACTGGATCATTTCCGACAA
    GGCTTGGCAACCCAGGTAACCCTGAGGGCGGAAACCAAGGCGGGTGGTGACCCGGGAGGAAGGGCTACAC
    TGCCTGAGAGGACGGCTCTGTTCCCCAAGGACCTTGTTCAGTGGCCACCTCCCCCTGGAACGGAGCCCTT
    GGCAACACCCAACACCCTGCCTCCCTCTGGCTATGTGCTGAGTTAAGATCTTCCCACTTCTCCTTTTTTT
    GAAGTGAAGGAAGCAGACCCAGCTCCCTGCAGGCGAAGAAGCAGAGTCTCCCTTGGGCACACCGCAAGCT
    CCTTGCCCCCGCCAAACGCACTCACCCCAGCCCTCACCTTAAAGTCATCCAGCAGAGACTGGGTCAACAG
    TAAGCTGTGCAGTTGGTCCTTCATTTGCTGCAAGAAGAACAGAAGGAGAATGAACCCAAGGTTTGGAGCA
    ATACTGAGAAGGACTGTCTTTCTGATATCCTTTTATTGAGAGACTTTTTGATTTTTAGTCAACACAGCCC
    TGTCTCCAAAAGGGAAAGGAGAGGTTTTGAAACAGGACATTCAGCAGCGCTGAAGCCCTTAGTTAAACCA
    GGTCCTTCCTCCGGGGATCAAGTTCTTTTAAAAACCTGGCTGATTTTGAAGGCAAGGCAGAAGCCTGCCT
    GGGTCCCAGTCTTCTTTCTGTAGAGCTGCGTCACGTGTGCAGGGACCCCCATTCCCAACCCCTCAGCACC
    CTCTGCTTTGCTGTCTCCAGCTGCAGCACTGACCGTTCTCTGGGAGTGGCAAGCATCTTCTCCTGCAGGT
    CTCCCCCTGTATGCGCTACCTCCAACCCATTTGTCATTCAGGTTCTGGAAGCCCTCCAAGCTGAGGCAAC
    TTTTGTATCCCTGCCACGGGGTTTTGGGAACATCTTCACCTCCAATCAGATCTCTCCCAGCCAATGAGGT
    ATTGAGCTCCAGAGGAATCCTTTACAGATTTTCTAGCATAGGCTAGATGTGCCTTTACATTTTTAAAGAC
    AACTTTTCTTGCACAATCTGCTACATCACCAGAGCTCAGATTAACTCACTGAACCCACAGTTTGACCAGG
    GACTCTTAAGAATTTCAGCTTCGAGGGGAATGGGTGCTGAGGGTGGAGGTGAGTGAAAAGGAGGCTCTTG
    TGAGTGCCTGCAGAATGGCTCTTCCTGCGGTCCTAAGGGAGAAATGAAGGACAGGAGGGCTTTATACTCA
    CAAAGAAAGTCTTCACCTTGCCGAAGGCAGCTCGGAGCTCCCGCAGCATGTGGGGCAGGCTGGTTGGCAA
    GTGGATACAGCTGCTGTCAGACAGGGTGCTCGCATCTCGGCTGGCTGCCACCCCAGCCAGGAAGACCAGG
    CAACAGAGCAGGGCTGAGC
  • Protein Sequence : Show Sequence
    >gi|41386772|ref|NP_776513.1| interleukin-10 precursor [Bos taurus]
    MHSSALLCCLVFLAGVAASRDASTLSDSSCIHLPTSLPHMLRELRAAFGEAKTFFQMKDQLHSLLLTQSL
    LDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVE
    KVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): Mycobacterium avium relA mutant vaccine
4. IL17A
  • Gene Name : IL17A
  • Sequence Strain (Species/Organism) : Bos taurus
  • NCBI Gene ID : 282863
  • NCBI Protein GI : 56605852
  • Locus Tag : BOS_21471
  • Genbank Accession : AF166487
  • Protein Accession : NP_001008412
  • Taxonomy ID : 9913
  • Chromosome No : 23
  • Gene Starting Position : 24346987
  • Gene Ending Position : 24350508
  • Gene Strand (Orientation) : +
  • Protein Name : interleukin 17A
  • Protein pI : 9.15
  • Protein Weight : 15852.85
  • Protein Length : 153
  • Protein Note : Also known as IL17; IL-17
  • DNA Sequence : Show Sequence
    >gi|258513344:24346987-24350508 Bos taurus breed Hereford chromosome 23, Bos_taurus_UMD_3.1, whole genome shotgun sequence
    TGTCCATCTCACAGCGAGCACAAGTTCATCTGTCTACAGTGAACTGGAAGGAACTACCATGGCTTCTATG
    AGAACTTCATCTATGGTGAGTCCTGAACTGATGTGTGATTCTCTTCTCGATTTAGGCCAGATCAATTTCT
    GGACTGCGGGCATGAAATTCTGGATTCTAACTATGGAAATACAGTCTATATAGGATGGGAAATGAAACCC
    TTGATAGATATTTGTCATTATTGAGCATTTTCAAGAACTGGTGCATATCAGTTTGAAAGATGAGATTAAA
    ACTGAAAGATAGCTAGACTGGGGCTAAACCACACAAGAAGTGTCAACGTGACATTGTGCTGTAAGAGAGA
    ATGCTTATTGAAAATCTGTTTCTCTGGGTACAAGGGATTTAATATAATTCTTCCACAGTGTTTTTCTTTA
    ATTCAAAATAAGATGGGTCACTACCCTTGAAGATTTAATGTTTTGGCAGTGACTCTTCTTTCCATTATTG
    TATTATTATACTATAGTCTTGGTACACTAACCCTATTTTCTTAGGTATGTTTCCCAGCTTTTCCAAATTT
    ACATATATTGATTCTGTAATCAAATTGGATTTCAAAAAAGATGCTTTAACAATATTTTAAAAACAGAGAC
    CTTTTAATTCTAATCTAAAGTTATACATGCGTCTTTTTTGAAACCCAATTTGATTACAGAATCAATATAT
    GTAAATTTAGAAAAACTGGGAAATATACTTAAGAAAATATAAGAGGGTGTTGAGTTTGGGCTTGGACATT
    TGCCAGTGGTACCAACAGAATTTCTAACTGATTCCACATGGATTTTATACAGCCCTTTATGTCTAAGGTG
    TGCATTCCCTTTTATGCAATGTTTCACAAAATGTAAGAGGAGATATCAATGGTGTAGAAGGGCATTTCTT
    CCTAGAAAATCAAGGTCATTACCCTTCCAAAGACCTGAGAGTGATGCATATACTGATATATTGATGACTT
    GCCATCTTCACTAAAATTACTGTCAGCCAATGAATAATGTGGTTTTTCTACTTTAAAAAAAAATGTTCAA
    GACTGGTAGAAATGCCATGGTCCTAATGTCACTTTAGTCATCTCATCAGCTTTTCACTTAACATATTTGA
    AAATTTAGTATAGATTGTCCTGGACCATAGAATGTTCTCTACTATCAGCAATTTAATCATTACCACAGTG
    TGTTAACAAAAACCATTGTAGTACTAACCCAATCTACCTCTCTCTCCATCCAGTCACTGCTACTGCTTCT
    GAGTCTGGTGGCTCTTGTGAAGGCAGGAGTCATCATCCCACAGAGTCCAGGCTGCCCACCTACTGAGGAC
    AAGAACTTCCCGCAGCATGTGAGGGTCAACCTAAACATCGTTAACCGGAGCACAAACTCCAGAAGGCCCA
    CCGATTATCACAAGCGCTCCACCTCACCTTGGACTCTCCAGTACGTAAGCACCCCAGATAAAACCTCTGC
    ATTCTTCTACATCAGAAGAACACATCAGACTGCCAGTTAAATCATCTGAGGGGGGTGATATTACTCATTC
    AGAATCACCTGTCAAACCTGGAAGAGCCATTGTTCAAACTAGTGATTCTCCAATTTTCTTTCTACAGATT
    TCTTTCATAGATCACAGCTCTCCCCAGCCCATCCATAACACCTAGCCTACGAGTTCTCGATGTCCCCAGA
    ATCCACTTAAATGAATGGTGGTCATCATTCTGATATTTATGACACCCCAAGTCTATTGTTTATTTACCCA
    AAAAAGAAACAGACATTTAGCATGGGAGATTAGTACTGGAATTCTCTTTCCCAGGGCTACCAGAGAATAC
    CCTGGTAGAGTTTGTTGACAACAACAATCAATTAACTGGGATTTTTGTGCTTTTCTTGGTTATATTAGCA
    CTGGGAAAAGTGGATTAGCTACTGGATTAGCTTGAATCCCAGTAGAAGAAGTGTTCCATTGGGTGTTTCA
    CCGTTTTTTGACTTAGTCTTGAATTACATCCCCAACAGACTGACATTCGCTGTGTCTTTAATACATCTAG
    TGGTGGTGGTGGTGGTGGTGGTTTAGTCGCTAAGTCGTGTCCGATTCTTGTGATCCCATGGACTGTAGCC
    CACCAGGCTCCCCTTTAGACCCTATGATGGATCAAATACAAAATGCATTTTGATAATTTGATTTCAGGCA
    AATGATCTCAGTTATGTGGAGCCTACAGATTCACTTGTCTATAGGGTCTTTTCTTCTTACTTACTTACTT
    ACCAAGAATAGTTCAAATAACTTAAACTAAGTCCAATCACTCTCTCAGCCAGAGGAGAGGGAGAAGGGAA
    AGTTACAGAGGGGCTTCAGATATTGTTTCCAGCCCTTCCTGTCACCCGTGGGCTCTGCTCCATCAGTGTG
    TTGTCAGATAAATTTGGATGCCTTTCTTGTTTCAAAGACAGACTTCATTAAGTCAGATTAGCAGCTATCT
    TGTTTCTAGATGACTCTTAGTTTTTTTAATCTATCAAATGCACCCTAAAAAAATATCCTTTATGACAAAC
    AAATCCTTTCTGTAGTTTCAGTCTGTCTTCTTTTGTTTATTCTTCAAAGAACCTGGGGAAAGCTGATCAT
    TGTTTCTTTTTTCTGTAACATTTCATGGGCTTCCAAATCCAAGTTTTTCCCAAATGGCTTGTTTTCCAGA
    CTAATAGCACTTAGAGAATTTGCAATGCCTATCATGTCAATTTGCCTCCCTTTGCTTATTCCTGTTTGAT
    TTCCTTACTGCTCTACCAGGAATTCACTTTCTTCCTGGCTTTTGTCTCCCCTGCAGCCGCAATGAGGACC
    CTGAGAGGTACCCCTCTGTGATCTGGGAGGCCAAGTGCAGCCACTCAGGCTGTATCAATGCTGAAGGCAA
    GGTGGACCATCACATGAACTCTGTCACCATCCAGCAAGAGATCCTGGTCCTCCGAAGGGAGTCTCAGCAC
    TGCCCTCACTCCTTCCGGCTGGAGAAGATGCTGGTGGCCGTGGGCTGCACCTGCGTCACCCCCATTGTCC
    GCCATTTGGCTTAAGAGCTTTCTGCCTGACCCCTACTCCCCAAATTAGTTAGGTTTCCTGGGGAGTAGGC
    CCAGCCCCTTTTCTAACTAACATCATTTATGTATTTAATAAGCCCTGAAATAACTTTGGGGCATAAGATT
    CCACTTTGATGTATTACATGCTTTATTTTCTATTCTTTTAAGACAAGTTTCCAGATTTGTGAATATTATT
    ATTTAAAAGGTAGAACCTATATTTATATGAGCTATTTATGGATCTATTTATGTTTCATTAGTCTTTAGAA
    AAAAGGTGAAATATATGAGTATCTGTTTTGCCTAGGGAAATCCTAGATAGGATTAAATAGCAGTTGAAAA
    TGTCTGAGCTTGTACTACATATGGCTATAGAATTTTCTCTTGCTTGTCTCTTTGGAGTACATAACACAGC
    TGAAAAGAGACTAAATTTAGTTTCATATTTATTAACTTAATTTTGTAAATTATTGAGGCATTACAAGAGA
    GACAGCAAGTCTAACTGCTCTA
  • Protein Sequence : Show Sequence
    >gi|56605852|ref|NP_001008412.1| interleukin-17A precursor [Bos taurus]
    MASMRTSSMSLLLLLSLVALVKAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTS
    PWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAV
    GCTCVTPIVRHLA
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): Mycobacterium avium relA mutant vaccine
5. IL22
  • Gene Name : IL22
  • Sequence Strain (Species/Organism) : Bos taurus
  • NCBI Gene ID : 507778
  • NCBI Protein GI : 148356272
  • Locus Tag : BOS_5234
  • Genbank Accession : EF560595
  • Protein Accession : NP_001091849
  • Taxonomy ID : 9913
  • Chromosome No : 5
  • Gene Starting Position : 45721766
  • Gene Ending Position : 45727534
  • Gene Strand (Orientation) : +
  • Protein Name : interleukin 22
  • Protein pI : 9.05
  • Protein Weight : 20001.55
  • Protein Length : 190
  • Protein Note : Also known as IL-22
  • DNA Sequence : Show Sequence
    >gi|258513362:45721766-45727534 Bos taurus breed Hereford chromosome 5, Bos_taurus_UMD_3.1, whole genome shotgun sequence
    CACAAGCAGAAGCCTCGATACAGGTAAGTCCTCCAACGAACTTGGTAGGATTGGCTTGCTGGGTCTATTC
    CTTCTGGATACTTAATTTTTTCCCTTAATGTTGATTTTGTTTCTCGTTCTCTTGATACCAGGTTCTTCTT
    CCCTAGTCACCCATTGCTCAGGTTTGCTTTGTCCACGATGGCTGCCCTGCAGAAATCTGTGGGCTCTCCT
    CTCAGGGACACTCTGGCCGCTGGCTGCCTCCTTGTCATGGTGCTGTGCGCCCAGAGAGGAGCGGCTGCAC
    CCATCACGTCGCACTGTAGGCTCAACGAGTCCGACTTCCAGGAGCCCTACATCTTCAACCACACCTTCAC
    TCTGGCTCAGAAGGTACTCATCTCAGTCTTTCTCTTTTGCATCTTATCTACTTGGAACCTGAATAGTTCT
    TAAAATTTCTTCAGAGGACATCTAAGATCTTTAACAGATGAACATTAATCGCTGCTGGTATACCTGTCAT
    CATTTTCTATGTCTCTTTTAAGACTTTTTGGAGATCAAGCTTTACCTCAAGCCCTTCCATTTGCCCGTTA
    GGAAATGTACATTCAGTTTTACCCCCAAAGGGGCCATGTAGTAACCCATCTGACTGTTTATGGTTCCCTT
    TACTTCTCTAAGCATTCTTTTAGTTTTTGAAGAGAAAGAAATTGACATTTTTGAGCACTTACTATGTTAT
    GAGCTCTATTCTAGGAGCTTTAAATCCATTCTTTCTTTTTTACTGAAGTATAGTTCATTGACAGTATTAT
    TTAAGTTCCAGGTATACAGCATAGTGATCCACAATTTTTAAAGATTATTCTCCATTTATAGTTATTATAA
    CATATTGGCTATATTACCTATGCTGTACATTATACTGTTCTATCTTATTTTTTAAATTTATTTTGAAGTA
    TAGCTGGTTTACAGGGTCATGTTAGTTTCCAGTGTACAGCACGCTGATTCAGGTCTATATATATATATAA
    ATATACGTACATATGTGTATATATAATATATGCATATTCTTTTATATATTATTTCCCCTTATTGGTTATT
    ATAAAATATTGAGTATAGTTCCCTGTACTATTTAGTAACTTCTTATTAGTTGTCTATTTTATACATTGTA
    GTGTATATATGTTACTCCCAAACTTCTAATTTATCCCTCCCCTCAACCCCTGAGCATCATTTTAAACCCA
    TGCACTAAAGAATCCTTTCTTTAGTCTTCACAGTGCTGCTCTGGGAAGAGGGGACAGAGTACAGCTTTGC
    TTACAGACATTTCTTCTAGCTTTATGATGTCCAGGCACTTAGTCTTTTCTTTTCTTCTAGGCTAGTTTGG
    CAGATAACATCACAGATGTTCGTCTCATTGGGAACAAATTGTTCCACGGAATCCATGTAAGCCATAGGCA
    TGATGCCACTTGTGGTTACTTGGAGTGGTGGTGAGGATGGGCTGGGTCTTGTGGATGTCGCCTAATTTGA
    GCCCTGCTGTTTCACTTTCACCAGCAGGTGACGAAGCGCTGCTACGTGCTGAAGCAGGTGCTGAACTTTA
    TTCTTGAAGAGGTGCTGTTCCCCCAATCTGACAAATTCCACCCCTATATGGAAAAGGTGGTGCCCTTCTT
    CTCCAGGCTCAGCAAAAAGCTAAGCCAATGTGTAAGTTCTTCTCCAGCCTGAGTCCAATCCTCCCAGTGC
    CTGCCTTTCCTCTTTCTTCTGTGTAGAACCCTCTTCCTTCCCACCCCAGTGCCCCTTCCATGCTGGTAGT
    GAGAGGTGCCTCTGTCACACCATTACAGAAATCATTTGGCATCACAACCTGTTTGCTTTTGCTTTAACTG
    AGTCACATTTTGAGTTGATTGTGATGGGCAGGGTCTGATAGACCACAGGAGGCTCATTTGTCCCTGGGAA
    AAAGCGATTTGGACTCTGTGAGATGAGAAAGGTGTTGGGAGCTGTAAGGAAAAATACCTATTGGTGCAAA
    TGGATTCACTGAATATAAGTTGATGGAGGGAGGGGATGGGAAAGAGAGAAAGGGAGAAACAAGATTTAAT
    ATTCGGCAGTGGGTGGGTGGATGAAGACTGCTGCCCTTTTGATAATGGAAGTGACAAAATCAGAGGTGCA
    TGAGTTTGATGCCTCTGAATATTGAAAACTAAGAAAAATATTTTGGTGGAGTAGGCTGAGCAAAAGGGGC
    CTACTATTTATTGAGGAGGGCCCTGTTCACATAAGATGTTTTATGTAGGTTTCTTGTTCTGAGCCCATGT
    TTTTGATGAGGTGCCGTTATGGTTTTATTCTTGACAGGATTTGCATAAACCACTCCGCTCTTTCCACAAA
    CTTCAACCTCATTAGGGTTGCCCAGAGGTGAAGTGAGGTCCCGTGTAAGGGAAATGACTGGATTTTGGTG
    TCCCAGGGAATTGAAGAGGTCAGAAAATCTAGGTCACTATTGATATCTAGGTCATTGTGGGCAAAATTGC
    TAAGAACTTTAATTCCAGATGAATTGTAACATACTTCAGTTAGGAAGGCTGAGTTTCAAAATCTTCAGTA
    CAACAATGTTAAACTTGTTACTCTCATTTCCATTTTGTAGCATGTTGAGTCTGACAACCAGCACATCCAG
    AGAAATGTACAGAATCTGAAGAACACAGTGAAAAAGGTACTACTAACAACTATTAGTACTAAATCATTTG
    ATAGAAGAGACAAATATTGTTTTTCTTCCCTTTCTTTCCTTTTTTCTCCCACGTCATGATTTTTTACTTG
    ACTCTCCTGCCATTGGGTTGATTATTCAGGTGCACATTAAGTATAGATGTGTCTATGCTATGCTATGCTA
    AGTCACTTCAGTCGTGTCCGACTCTGTGTGACCCCCCAGACGGCAGCCCACCAGGCTCCCCCATCCCTGG
    GATTCTCCAGGCAAGAACACTGGAGTGGGTTACCATTTCCTTCTCCAATGCATGAAAGTGAAAAGTGAAA
    GTGAAGTCGCTCAGTCGAGTCCGACTCTTAGCGACCCCATGGACTGCAGCCTACCAGGCTCCTCCATCCA
    TGGGATTTTCCAGGCAAGAGTACTGAAGTGGGGTGCCATTGCCTTCTCCGTAGATGTGTCTACATGTTTA
    TAAGTCAGTTTCCAAATTTTGCAAATTCTAGAACTGGCTGGGAACTTAAGACATTGACTTATTGTCACCC
    ATGTGCTAGGGATGGCCAGTGTCAGAGTCAGAATAGACTGCAGGACCTCTGAATCCCATCCAGGCCAGAA
    GTGCTGGATATTATACTTAGTCTCATTAGTTCTTAGGGAAATTTTAGATACCTACTGATTCATTTAGTCT
    GAAGAAGCATTTGTTCAAAACCCAAAACTGGGTAAAACTTATTTGAAAGAATTTTGAAGTCATTCACATG
    ATGATGTAAAACTTGAGAAATATACCTAGAACAGCCATAATAAAAGAGCTGGACTTTCACATAGGATGAA
    TTTCTGGAATGGTTTGATACTTATATTTAACTATTAAAATACCCAGCAGCTATTGGTTTTAATTTAAAAG
    TGAGAGTGAATGTCCCCCCAGTCTCTTTTACACAGTATCAAATAGAATAGAAATATTACTATTAGTAATG
    GATTCATTGTAGGGAAATGAATGTCCACACCGGAAGCCCTCTTTCTTCCTCTTTCCTTTTCCTTCTTTCC
    TGGTCTATTCTTTCCCTTGACAATGTGCTAATGAGCATCTATCTGATATAGTTTAGTGTATATTTTGACA
    GAGAATGATATTGTCGGGTGGCCTATTTGGGGGGAAAGAACAACAGGGGAAGGCTCAGCTCAGCTGCTGT
    GACTCATCCAAAAACCAGAGCTACCATGAGCAGCAGCAAAAGTGAGGATTTGGTAGGCAGGTACAATTAA
    ACCTCAGAAACAAGAATGCTCTGGTTGATGGAATTTTCAGTAACAAGCATAACCTCAATTCCCCCTTTTT
    TCCATCTTGATTTTTTAAATAAAAAGTATCTCTTCCTGAATGTGATTTAATGAACATTGTCAATGTCTTC
    CTTTGATAACTTAAGGATTTGTTTTTTTCATTGTGAAGATAAATTCTCTTGTCATAGAACGATTAGCTAG
    ACACAGAGGGCTGAATATTAGCATGCCATAGCCAAGAAGTACTTTGCATTTCTGGTGTGAAAAATTCCTC
    ATATGAGCTTACTTTGTTGTCTTTAGAAAAGTGGAGTGTGGGAGACAAAAAGCTGATGGTGATTTGTGTG
    GGAAAACAGATTTTAAAGCTCTTAATCCATTTTGAAGGAATTGACTTACACATTAGCAATCAGTTGCCAT
    GTGGATGAGTTGTTATGCTTTTTTTTTTTTTTTACCCTGTAGTTTCAGAAAGCCTAGTGAGAGAGGAATA
    TTATTTAGAGAAATCTCAGCATGCGTAAACACTGGTCAGCACTATGAAATGGGAGGGCATCTTGGGGGGA
    TAGTAATCCCTTGTCACTGAAGAAAAGTAGAAAGCAGGCTGTAGCAGAACAGAGAACAGATAGTAGAATT
    GTTTATCATCTTGGGAGTCTTTGAGATATTAAAAAAATATCTCTTGTCGTTATGTCAAAGGAAGTATCGA
    AAGGTGGAAAGATGGAAGAAAGCAGGAAGAGAAAGACCAAAGTCTAGAGGACAATGATGACTTAGGGTTG
    CTGTTTTCTTTGAAATAATCTTGAGCACATTTAATAGATTAGACAAGTTTCAGAGGAGGGGATTTAGACT
    TGTGTTCCCTCTCCCATGGGGTTTAAAAGACTTTTGCCTACTACTTGGAAGGAGGAGGAAAGAAAGGGTG
    TTAGACTGTATCTGGCCTTTCACTGTTAAAGCAACTAGATAGGAGACATTTGATATTTCCCCCACAAAAG
    TGAAAACTTGTTTTCCCCACCTTGGTCAAGAAAGTGGAAACAGAAATAGTCCACATGTTTTGGTACATGT
    GGTAGTTTTGGTTCAAGACTATTGGAGTTGAGTGGTTATACTAACTGATTGGTCACAGCAGTCATGGGAC
    TCAGAGGCAGGGCAAGGAGGGGTGAGTGGTGCTTGGGTCCCCCAGATCCCCCAACAGCCTCTACCTGCTT
    GCTCTGGTTCAGCAGTGATTTAACACATCAACCAGCTGAGACTGATGCCCATAGGTGCCCTCTCAGATCA
    GGTCATATATTTTGAAAAAGGGTATTATCACTAATCTTTTATAAAATGTTAAAACTTGGTTTCTGTTCCA
    ACAACCTAACCATCTCATCTCTCTCTAATTTGTTTCTCTTTAGAAAACATGGTATAAATGCTGAAATACT
    TGTGTGTTCTTATTTTCACAGCTTGGAGAGAGTGGAGAGATTAAAGTCATTGGAGAACTGAACTTGCTGT
    TTACAACCCTGAAACGTGAATGTGCTCAAGTAGACCAAGGCTGGAAAATGGGTTACTAACCTTTCTCACC
    TGCTAAACAATAAGATCCCCTGAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAAAAAAGATTACT
    TTCTATCTCTTTAGAAAAAGCCCCTAAATAACTTCATTTCCATAATCAATACTTTATATTTATGAATTAA
    TTTATTGTTATAAGTACATGTCTTATTATTTATGTCACTTTATAATATGGGTTTATTTATGGAAGCATTA
    TAAAATATTTCTACTTAATTATAAGGTGAATAGTAATATTTATGATAATAATTATGGAGTTATGTTTATT
    TAGTCTCAATAAACACATCGATATCCTAA
  • Protein Sequence : Show Sequence
    >gi|148356272|ref|NP_001091849.1| interleukin-22 precursor [Bos taurus]
    MAALQKSVGSPLRDTLAAGCLLVMVLCAQRGAAAPITSHCRLNESDFQEPYIFNHTFTLAQKASLADNIT
    DVRLIGNKLFHGIHQVTKRCYVLKQVLNFILEEVLFPQSDKFHPYMEKVVPFFSRLSKKLSQCHVESDNQ
    HIQRNVQNLKNTVKKLGESGEIKVIGELNLLFTTLKRECAQVDQGWKMGY
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): Mycobacterium avium relA mutant vaccine
6. TGFB1
  • Gene Name : TGFB1
  • Sequence Strain (Species/Organism) : Bos taurus
  • NCBI Gene ID : 282089
  • NCBI Protein GI : 260655603
  • Locus Tag : BOS_17489
  • Genbank Accession : EF523342
  • Protein Accession : NP_001159540
  • Taxonomy ID : 9913
  • Chromosome No : 18
  • Gene Starting Position : 50771353
  • Gene Ending Position : 50785923
  • Gene Strand (Orientation) : -
  • Protein Name : transforming growth factor, beta 1
  • Protein pI : 8.85
  • Protein Weight : 42126.16
  • Protein Length : 390
  • DNA Sequence : Show Sequence
    >gi|258513349:50771353-50785923 Bos taurus breed Hereford chromosome 18, Bos_taurus_UMD_3.1, whole genome shotgun sequence
    NGCTGGTTGTACAGGGCCAGGACCTGCGGGGCGGGTGCGCGGGGTCAGGGTCGGGGGTCGTGGGGAGGAT
    GCCGCCACCCTGCCAGCCTCTCTCCCCATCTGCCTCTCTCTTATCTCATTCCGTGTCTTTCTGGTTCTCT
    GCCTCTCCCCATGTTCCACTCTTGGCTTGTATCTCACTGTCTTTCTCCTTCCATCTTCCAAATTCTCTAC
    CCTCCTACCTTTTTCTCTCTCATTCTGTCTCCTTTTCTTTCTCCTTCCATCTCCCCACCTCTTCCCTCGC
    CCAAGTTGGGATTAAGTCATTTTAGCCGTGTCCGACTCTGTGACCCCATGGACTGTAGCCTGCCAGACTC
    CTCTGTCCATGGGGTTTCCCAGGCAAAAATACTGGAGTGGGCCGCCATTTCCTTCTCCAGGGGATCTTCC
    TGACCCAGGGATTGAACCCACATCTGTCTCTTATGTCTCCTGCACTGGGAGGTGGGTTCTTTACCACTAG
    GTCTCCCCATATCTCTGTCTCCCACTCCCTTGAGTCTCTAACTTTGCAGACCCTGCCTCGAGCTTTTCTC
    CCATCCCATTATCACCTCCCCTCCAACCTTCCTCTCCCCTGTATTTCTGACTACCATCTTGCCAATTCAT
    CTGATTTGACTTCTCTTTCTCCCTCTCCTCACTCGGTTTCTGCTACCCCCATCCCACCCCCAGCTGGGGA
    GCAGGGGGTGTCGGGCTCCAGACGCACCTTGCTGTACTGTGTATCCAGGCTCCAGATGTAAGGGCAGGGC
    CCCAGGCAGAAATTGGCGTGGTACCCCTTGGGTTCATGAATCCACTTCCAGCCCAGGTCCTTCCGGAAGT
    CAATGTAGAGCTGACGAACACAGCAGTTCTTTTCTGTGGAGCTGCAGGCGGGAGGGAAAAACACTGTCAG
    GAGAGCAGAAGGCTGCCCCTCCTCCCCTGGAGTGTGTGTGTTTCACCCTGGTTGCCCTCCAGCATGGTAT
    CCAACTTGGTCTCCCTTGCACCCTCTGTGGTAATAACAGCAGTAATAGTAGTGATCATCGCTTACACTGA
    TAAAGCACTTCCTCTAGTCCAGCACTGCACTAAGAGCATCCTCATAAGCGTTATCTCAGGCAGCGCTCAA
    AACACACCTGTAAGGCACCAAATGAGGAGTTCCCAGGAGGCATCCAGTAGTTAAGACTCCAAGCTTCAAT
    ACAACAAAAAGAGAAACAAAAAACAAGCAAACAAAAAAAGACTCCAAGCTTCCACTGTAGGGTGCATGGA
    TTCGATCCCTGGGCAAGGAAGTTCCACGTTGCATGCTGCACAGTGCAGCCAAAAAAAAAAAAAAACTAAG
    CCTAAAGAAGCCAAATGACTGTCCACAGGGGACAGCTACACAGATCACACTACATCTATACACTGCGACA
    TAAACAGCACAGTGCAGGTCCATGTGTACTGATATGTTCTAAGTGTCCAACAAATGTTTACTCAACTACT
    GCGTGTTGGGCTGGGGTCTACTGCGGACTCAGTACAAATGAAACAGACAAATCCCTACCTTCTGGGGCCA
    CATACTAGAGACTATCATGTTGCCCCTCTGCTCTGAACAAGCCCAATGCCCAAGTCCTCGCCACAAGCTC
    AAGGAGCCACCAGATCTAGCTGATCTCAACTCCCTCCCCACTCCCCCTCTCTCACTGTCCTCTGGCCACT
    TTAGCATCCTTGCTGTTCCTGAGTCCCAGTCCAGGACCTTTGCACGTGCTGTTCCTTCTGCCTGGCTTGC
    TATTCCCACAGATACCCTCTCTGGCTCTCTTTCTTCACTCCATTTATACATGTGCTCAAACATCCTTCAC
    TTTGGGGAGTCTTCCCTCCTACAACACTGCCTGGCATGCAGTAGGTGCTCAATAAATATCAGTTAAACAA
    ATGACGTCATTGCCTCAGAGACCTTCCTGGATGATTCTATCCAAAACACCAATCTAAAAAATTGTTAATT
    CCTAGGGACTTTCTGGGCAGTCCATTGGTAAAGACCCTGTGCTTCCAATGTAGGGGGCATGGGTTCGATC
    CCTGGTCAGGAACGATCTCACATGCCATGAGGCACAGCGGAAAAAAAAAAAAAAAGGATAGTTAATTCCA
    TTTAGCGTAATAACGGCATTTCAGTTCTGCAAGGAAATATAAAAATGTCTGCAAATGAAAGGGGGCAAAT
    CTTAATGCCTGTTGATCTAGATGAGAGTGTATGGGGGTTCATTTTACCATCTTGGTTATACATTTAAATG
    TTTCCATAATAAAAAGTTTAAATCAGACTAGGAAAAACAAATCATCACAACGATTTCTTTCTTTCCTCTT
    CCTTGGATTTATATTCCTTCTTAGAACTTACTGCCACCTGCTCTTTTATTAGAGATTGATTTGTTCATCT
    GTTCATTTCCTGTCTTCCTCTGAGGACAGGACTTTTTGTCTATTTTGTCCCTAAAGGTGTCCCCACTGCC
    CATAACAGTCCCCAGCACCTGCCGTGTGTTGGCTGTATACAAGTGTATACAAGTGTTGGCTGTATACAAG
    TGTATACAAGTGTTGGCTGTATAAATTAACTGGTCAATGTTACATTTTTCAGAAGCACATCAGAGAGTGG
    TGGTGGGTAAGACGACTGCCATGTACTCATGATCTCTGTCCCAGGCTCAGATGCAAAAGTCAGTCCTCGG
    GCTTCCCTGGTGGCTCAGTGGTAAAGAATCTGCCTTGCAATGAAGGAGACAGGGGTTTGATCCCTTGTCT
    GGGAAGACCCCATGTGCTGTGGAGTAAGTAAACCCTTGTGCCACAACTATTGAGCCTGTGCTCTAGAGCC
    CATGTGCTGCAACTACTGTAGTCCCTGCACTCTAGAGCCTGTGCTCTGCAACAAGAGAAGCCACTGCAGT
    GAGAAACCCACACACTGCAACTAGAGAAAAGCCTGCACGAATATAATAAAAGTCTGTTTGGAGGGGGACT
    GAAGGGTCAGAACTGGAGAGTCTTTGAATATCCTTTCTAGGTTTGGTCCATGTACATGTATTTTCCTATT
    TAAAAATCAATACAGAATTTCCTACAAGGCAGGTCTTTTTTTTTTTTTTTTTTTAATATGTATTTGGCTG
    TGCCAGGTCTTTGCAGCAACAGGTGAATTCTTTGGTTGCCATATGAAGATCTTAGTTCCCTGACCAGAGA
    TCGAACCCAGGCCCCCTGCATTGGGTGTGTGGAGTCTTAGCCATTGGACCACCAGGGAAGTTCCAAGGCA
    GGTCTTATTCTATTATTCCCATTTGAAGGAGGAATAAACTGAGCCTTAGAGAAAGGGGGATGTTGTCTGT
    TCAAATGTAGGCTGTAGGTGGTAGAGCTCAGGGCCAGAGGTCTCTGACTTCATTTGCCCAGCCCAACCAT
    GTCAGCTCAAGCAGAGCGTGAGGAGGCGATGCCACAGGCTCTCCCAGGGCAAGACAAGGCCTTTCCAAGA
    GCCACAGGACCTCAAGAAGGAAGTCAGGAAACAGATTCCTGTGAGCTCAGCCTGGTCCCTCCTCAGTCTG
    GTTAGGCCTCAGTTCCTTCATCTGTACAAAGATGCAGGGAACGTTAGATCAAATAAGCTATTGTTAAGGG
    CCGAGGAGACATCAGGAAGTCCATGGACAGGCTCAGGGAGGGTTCTGAGCTCTCTAAACCATGCACACAG
    ATGTGTGTTGTTGTGGTTTAGTTGCTAAGTCATGTCTGACTCTTCTGTGACCCCCTGGACTGTAGTCTGC
    CAGGCTCCTCTGTCCATGGGATTCTCCAGGCAAGAATAGTAGAACGGGTTGCCATTTCCTCCTCTGAAGG
    ATCTTCCCGACTCAAAGATCAAACCTTTGTTTCCTGTAGCTCCTGCATTGCAGGCGGATTCCTTATCGAT
    AAGCTACCAGGGAAGCCCAGATATGTGTGTATGTATAGACATATTCTGGGGGGAAAAGGTTCCTGGCTTT
    CAGCTTCTCAAAAAGGTGTTAGATTCACAAAAGGGGAAGAACCACTGTCCAGTAAAATCTATCATTTCTG
    GTCCAGCTCTGCTGGGGTGCTGAGATCCTCTGATTCGCAGTGTGTGATTCCGTTACTCAACTCAACTGCT
    CTCCACGTGGGGTTCCTGGAGTAGCGGCAGCAGCATCGCCTGGGAACTTGTGGGAGATGCAAGTTCTCAG
    GCCCCACCCCAGATGCACTGAATCAGAAACTGGGGGATGGGGATGGCTGGGAGACAGCAAGCCACATTTA
    ACAAGCCCTCCAGGTGACCCTGAGCTACTCTCTAACCCTGGATGTTGGGGAAAGGGTCACAGAGGCTTCC
    CAGTGGAGATAGTGGTTAAGCTAAGAATAACTTTTTATTGCAGAAAGTCTCGGACATACACCAACCCACT
    CCAGTAGTCTTGCCTGGAAAATTCCATGGACAGAAGAGTCTGGCGGGCTACAGTCCACGGGGTCGCAAAG
    AGTCAGACGCGACTGAGCACAGCCCAGGCATGGGACATACACAAAAGCAGAGAATCTCACATTTAACTGC
    TGTGTCTCTACCATCCAGCTCCAGCGAACATCAAGTCGTGGTCAGTTTCACTGTATTTCTACCCGTATCC
    ACTTTCTCTCCTTTGACAAATGATTTTGAAACCCACGTCATCCATCATATTATTTCATCCATAAATATTT
    CTATCTCCAAGGAAATCTAGACTACTTTAGAGCATCACACAAAAAATTAACAGTAATTCCTTGATACCAT
    CAAATATCTAGTCAGAGTTCATACTTCCCCAACTGTCTCATAAGTATCTTTTTAATTATTTTATTTATCT
    ATTTTTTAGCCATACCATGTAGCATGTGGGATCTTAAGTTTCCTGACAAGGGATCAAACCCACATCCTCT
    GCATTGGAAGCACAGAGTCTTAAACACTGGACTACCAGGGAAGTCCCAATATCTTTAAAAAAAAAAAAAA
    GTTTGGGGAATTCCCTGGTGGTCCAGTGGTTAGGACTCCATGCTTCCAATGCAGGAGACATGGGTTTGAT
    CCCTGGTCAGGTTAAGATCCTGGAAACCGTGAAGCAAGGCCAAAAAGCAAATAAGTAAATAAAATTGTAA
    AAACAGTCTGCATACATAAAGACTCAAGTAAAGTCTATACAGGGCTATTGGTTGATACATCTTTTAAGAG
    TCTTTTAAAAATCTATATAAACCCATCTCTCTATTTCATCCCTTTGTATCGTATTTGTTGAAGAAACTGG
    GTCAGGTTTCCCACAATCTAGATGTTGCGGACTGCATGCCCATGGTGGCTGTTTAACATGTTTCTCTGTC
    CTTATATTTCTGGAAAATTGGGACTTGGACCTACCATTATTGATGGGCTTCAGGTTTGATTTTTTGGCAA
    GACTTCCTAAGTGACACTGTGTCACTCACATGGCTGGCTGCCTTTCTCTTAATGTTATAGCAGGCTGGCA
    CTCAGATTTTAATCTATCCATTCGTTCATAGGTTTGTTGGGCAGAGGGTAGGATCTGGTGATGAAGGATC
    TTGGAAACAGAGCTGACTTTCCAACAGGAGAAGTGCATGCAACAAAAACCAAAGGCACCATCAAAGTACT
    TAGCAGAGACGGGCCAAGGTCGGATTATCATTCTAAATTTGCCATATTCTAACTCTGAATTTCAAAATTC
    CAAGACTACAACTTCTCAGTTTTCTTAGACTGCAACATACTGGCATCTCAAGATTCTAACACAGCAACAG
    CTTTCCAACTTTCTAGAATTCCCACATCCCCACTCTCGAGGATCTTGGCATTCTGTTTTTTTTTTTGATC
    TTGGTATTCTTGAATTCCAATATTTTAAAACTGCATTCCAACATTCCACAGTTCTGAGCCCATCTCCCAA
    GAGGTTCAAGCTGCCACTTTCTAAGATCACAGGCTTCCAAGATTCTAACAAGACTCTAGCACTGGGACTT
    CCCTGGTGGTCCAGTGGTTAAGAATCCACCTGCCAATGCAGGGGACATGGGTTTGATCCCAGGTCAGGGA
    AGATCCCATATGCGCAAGCCGCAATTACTGGAGACAGAGCACCTAGAGCCCATGCTCCTCAACAAGAGAC
    GCCTCCTCAACTGAAGAAAGCGCGAGCAGCAGTGAGGATTCAGTGCAATCAAGAATAAATAAATAAGACT
    GAGTCCCAACATTCTAAGGTGCCAGTATTCTGGCTTTCACCGACTCCAACATTTTTGGAGGCTAAAAGTT
    CAACACAGGATTCCACCAATTCTGGACCTAATATTCAAGCACTCCAACCTGCCAAAATGGGAGAGTCCAG
    TCTGTCAATGGTACTCATCATGGGCAATCTTCCAGTTCTGAATTCCCAACTTCTAAGAACCCAACAGTCC
    TTGAATCCAACATTCTTTGATTTCAATAATTAATACCAAATTCTAATATCCTAGAATCCCAACGTTTTCA
    AACCCCAATCTGCCCACAGTACAGAAATCTAACACGGAGACCTTCCAATACTGAAGTCCCACATGTTCAG
    TGTTCCACATTCTAATAAATCTCCGATGCCAACCAGCCAGCAAGAGACCCGCCTGATCTCAACATCCAAG
    GACTCCTAGTTTGCACACACTCCAGCATCCCAGGCTCGGACCTCATGCCCTGAACCCTCCAGGCTGAAGG
    AGACGCTAGCCCAAGCAGAGCACCAGCCACATGCCCAACCTGTGGTGGCCGCTCAGTGGATGGCGAGGAC
    GCCCCCAGCCCAGGAGGCTGCAAGGTTCACCTGAAGCAGTAGTTGGTGTCCAGGGCTCGGCGGTGGCGGG
    AGCTGTGCAGGTGCTGGGCCCTCTCCAGAGGGGTGGCCATGAGGAGCAGGAAGGGCCGGTTCATGCCGTG
    AATGGTGGCGAGGTCACCCCGGCGGCCGGAACTGAACCCTGCTTTGGTTTTGGGAGTCAGGGGGGTGGGG
    AGGATTGGGAATACACACACACACTCAGATGGATGAATGATGAGGATGGGCAGGGGAGGACACACACACA
    CAGACACACATCACTGCCGGGCGTCGGCAGGGGTGGGGGGCAGGGAGGGGGCCTCACCGTTAATGTCCAC
    TTGAAGCGTGTTATCTTTACTGTCACAGGAACAGTGGGCACTGAGGCGAAAGCCCTCTATTTCCTCTGTG
    GGAGTGGGGAGAGGGAAGCCAGCATGAGGGGGGCGGCTCACCCATCCCTGCGGGGGTGGGCAGGAGAGGA
    AGGAAGTCGCAAACCCTTGGGGTATGGGGGGATCTCTTTCCTGCCCCTTCCCTTGCCTGACCCCTCACTG
    CACCCTCTCACTCCAGTTCTTGGCCTTGCAGCCTCCTTCTCCTCCTCCAGGTCTCAGCGCTGAGGCCACC
    TCCTCCAGGAGGCCCTCCAGGACACAGCCCCTCCCCCGACTGTGACAACACGTTTTTTTCTCCAAAGCAC
    TGACCTCTGTAGCTCTAACATTTGTCTTTGGCTATTTATTTCCCTCATTGTTTTCAGTGGCGAGCAGGAT
    ACTACGGGGGCAGGAAACCTTGTTTTCTTGTTCCCTGCTGGGCCTGGCCCTCCGTCTTAAAAACAAACAT
    CTCCTGAGTGCGCTGGGTGCCAGACCCTGTTCTAAACACTCTTTGTGCGTTATTTCCTTTAATCCTCACC
    AAAGTTCCCCATTTTACAGATGAGGAAGCCAAGGCCCACAGGCAGGGCTGGGATGGGATGCAAGGACCTA
    GGCTCCTGTCCCAAGGCAGGTGCAGAAGAAAGGTTTTACTTCTTTTTTTTTTAATATACAAAAGTAACGG
    GTTTTATTAACATTTTTTTGAAAGAATAGTTCGAAAAATGTTAACAAAACCCGTTACTTTTGTATATTAA
    AAAGTAGTTAGTCACTCAGTTGTGTCCAACTCTGGGACCCTATGGACTGTAGCTCACCAGGCTCCTCTGT
    CCATGGGATTCTCCAGGCAAGAATACTAGAGTAGGTAGCCGTTCTCTTTTCCAGGGCATCTTCACAACCC
    AGGGATTGAATCTAGTCTCCTGCATTGCAGGCGGATTCTTTACCATCTGAGTCACCAGGGAAGCCCTTTT
    GAAAGAATATGTATATCTAATAATCATAGCAGTATTTATCAGTTGTTCTTATTTTTTAGATTAACTTTTA
    TCGGAGTGTAGTTGCTGTACAATGCTGTGTTAGTTTCTGCTGTACAGCAAAGTGAATCAGCTGAATGTAT
    ACATACATCCCAGAAGAAAGGTTTTTTGAATGAATGGCTGAATGAATGCTTCCCTAAGCACCCACTATTG
    TGTGGGACCCTGTATCAGGTGCTCTGGACTCAGCAGTCAGCTTAGGACACTCGTCCCAGTATGCACCTGC
    CCCCGAACTCCCATCCTTTCCTCTGGTCAAACCATCACCTCTTCCATGAGTCTCAACACAATCATTCTCA
    CCCAGAAAGCTCTCTTGGATCCCCTCAGAGGGGTTAGGGTGCCCACTCTGGGCTCCTATAGCACTTATGC
    CTCCCCCATCCCGGCCCTGCTCACCCTGGCCATCATGGCCTGCTAGGGCTTTGGGAAAGATTTCCTGGGT
    ATCTAGAAGTGAGTGCAGGTCCCATGAGGGCAGGCCTAGAGGTTGTCATGGTTACCACTGTGTTTCCCCC
    ACCCTACCAGCACAGGGCCAGCCAGAGAGCAGGAACCTACTAGCATTTACCCCAGTGAAGGAACGAATGA
    GAGGGAGACTAGGAAGGGAGATGTGAGCACTGGGGCCTTCAACATGACAGGACAGATGGTCCTCTTCCAG
    ACAGAACAGGTGTGTCAGGCTTTCCCTAGACTCGAGGCCTCTGCACAGCCTATCCCTCTGCTTTGAACAC
    TCTTGCCCCTCCCTCCTTTCCCAGGCTGGCCCCATGAATCCCTCCGACACAGCTCCAATATCCCCTCCTC
    CAGGAAGCCCTCCCTGACCTCCCAGGCTGCATCAGGCACCTCCCCTGGGCTCCCCATCCCAACCCTGCCC
    ACACTGGGACATTACTACCTGGTTTTCAGGTCTTTCCCCAAGTCCCCCAACCCCAGCAGTGGAACAGGAG
    CTTCCCGAAGGTCAGGATGAAGCTGTTTTCGTCACTTCTGTGTCTCCAGCATCACCCAGCACAACGCATG
    TGCTCAAGAATGGATTAGCCATTAATCACTCAGGTGTGAGTGTCTGGGAGGAGGGCCAGGTCTGGGCTCT
    TTGGCACCAACACAGGGCGGGGGGTGCTAGGCAGGGTGGTCCCAGGACAAAAAATGGGTTACAAAACAGA
    GGTGGGGCAGACAAGTGGTCCTCACCTCTGCGGGTCAGCCACTGCCGCACAACTCCAGTGACGTCAAAGG
    ACAGCCACTCCGGTGAGTCGCTGGGGGCGAGCAGCCGGTTGCTGAGGTAGCGCCAGGAATTGTTGCTATA
    TTTCTGGGGGATGAAGAATTGGGGAGTGAGATAGTGGGTAGAGGCTGCCACAAACACCCATGTACCTTGC
    ACCTCTCACTCCATCTGCTCCCCAAAACGGGTCTCCACACAGTCCATCAGTCCCCCTCCCAGACATCCAC
    ACTGAGGGGCTTCACAGAAACCACCCAACTCCATGACAGGGGACAGAGAACTCCAGGCCAGGGGTCAAGG
    CACCTAGGCATTTCAGCCTCCACCCTTGATCCCGCCATGGCTGTGGAAAATTCCTTTCTCTTTTTTGGCC
    TCAGTTTCCTCACTGGTGAAATGCCCAGTTCCTTTCAGCTTGGACAGCTCATGAGGCTAAAATTCTCCTA
    CTGACATCACAGAGGTCAATGACGATACAGCTCTGAATTCTTAGAGTCTATCGCTTTCTAGAAGTTATGT
    TCGAAGTCATTCCATAACTCCAGCACTTGGTGGCACCCCAAGAATTACACATTCTATGAACTCGAAAAGT
    TTTATGAGATTCAAGTTCAACAAACCCAGGAGTCCGACGTGCCAGAAACCTAGACGTTGCAGATGCCTGA
    CATCCACGAGGAATGACGCCCTGGGAACTGGCAGCATAAAGCCGAGTTCTCTAGATTCCGAGCAGTTAGT
    ATCAAAGCTTCCTCGTCGTAAGAGTCTAACATCTACCACTGAATCTAACACTCCATTTGACAGGGCTTCT
    AGGTCACATAGCCTTCGAGAAAATCCAGATTTTTTGGACTCTTCCTGGAGACTCTTCTAGAACAGAGCTA
    TCCAAGAGAACTTTCTGTGACGATGCAAATGGGCTTTATCGGTGGTGTCCAAAATAGCAGCCACTCACTC
    CATGTGACTACGAGCCACTTGAACTATGGCCAGTGAGACTGAGAAACTGAATTCTTTCTTCTATTTAATT
    TTAATCCACTTAAATGGCCATATGTGGCTAGTGGCTACTGGGTGGGCACAGGGCATTTTGAAAGTCTCCA
    ACTTTTCAAAGATTCCAACTTTCCTTGTCCTGAGTTTTCAGAGTCCAGCTCCAAAGATTCCAGCTGCTAA
    GCATTTAACATTCTAGGGCTCTAGGAGACTCCACACTCTGTGCTCCCTCATCTTTCAGGGTTAGTCCATG
    TGGACCCTGCAGCCACCAGCCTTGCGGCCGTCCTGGGACCACCCTAGCCCAGGCCACTTTCCGGGACCCT
    TGCCCCCACCTGGTACAGCTCCACGTGCTGCTCCACTTTTAACTTGAGCCTCAGCAGGCGCAGCTCTGCC
    CGAGAGAGCAACACAGGTTCGGGCACCGCTTCCCGGAGCTCGGACGTGTTGAAGAACATATATATGCTGT
    GCGAGCTAGACTTCATTTTGTCATAGATTTCTAGGCAGAAAGAGTCGAGGGTAGGGGGGCTGTCAGTGTT
    TGGCAAGGGCAGGGGAGCTAGTGTACCCCAAATCGAAGAACTCTGGGTTGGACTCCGACCCTGACACTTT
    TTAGCTGTGTGACCTTAGGTAACTAGCTTCTCCTCTCTGAGTTTGTTTCCACCTCTTTATTATTATTTTA
    AATATTTATTTATTTGGCTGTGCAGGGTCTTAGTTGTCGTGTGGGATCTTCGGGCTTCGTGCAATGTGGG
    GTCTTTAGTTGCAGCATGCGAACACTTCGTTGCAGCATGTGAGATCTAGTTCCCTGACCAGGGATGGAAC
    CTGGGTCCCCTGCATTGGGAACTTGGAGTCTTAGCCACTGGACCACCAGGGAAATTCCTCTAGCTCTTTA
    AACAGGGTCCTATCCTAACCCTCTCATCAGGTAGGAAGTGGCCCCTCAGTACAAAGCTGGCTTGGGGGTG
    GGGCTGCTCTGCTTGCTCAGGCCTCCCCACCACCGGGAGCCTCAAATGCAAGTTATGTTGAAGCAGAGAG
    ATAAAGGGCACTTGGATCAGACTATGCCTTTGCTGCCTTCTGTGACCTTGGGCAAGTCACATTCCCTCTT
    GGAGCTGTTAAATCTACTTGACATCAAGTTCTCTGCCTCCCAACCCAGGCTCTCCTAACTGAAGCGCAGT
    GGAACTTTGGGCAGATGAATTCGTCTCTCTTGCCAGATTCTCACCTATAAGCCAAGGACTGATGACAGGA
    TGACAGTGTGAAATAGATGAGATGATGCAGATAAAGTATGTCGCACAGAGTCTGCATACAGTGGTTACTT
    TAATGTGTGTTCAACAACCCCATGAGAAAGATTCTATTAGTATACCCATTTTATAGATGGGCAAAGAGAG
    GAAACAATTTGCCCCTAAGCAACACAGCCAGGAAACTACAGTGTGGGGTGGGGATTCAAACTTGGCCAGT
    CTGGTCAGAGCCTATGCTCTTAATCCCTAGGCTATGCTCCCTCCCTGCTAATGTGACATTATTTTTGTTA
    TTATTTGTAGTATTTCCTCCCTTAACTGGCTAGAGAAAGTAAAGTTCACTCTAGATAAGGATGGCTTCAG
    GGGTGGGGGAAGGGAAACAAAATTAAGAAGACTCCCAGTTCAGGAAAAATTGGGGACTGGGAATGAGGGG
    GGCAGGCCATGATCAACTGGAGCAGTTTCGTTAGGCCTCTGCAGTGGGGGCATGGAAATGGTGGAGACAT
    GTTGAGAAAAGACAGAGGAAGACCCTCTTGAGCGCCTCCTTCCCCCTGCTCCTCCCGTCTCTTGGTCTCT
    TGCCGGGCTGGCCCCTTTCCCTCACGAATAAGCTCTATCTTGGCCCAAGAGTTACTCAGCCGACCCAAAC
    GGAAGGGCAGAGCCCAGGCCCAGGAGACAGGGAGGAAGAGCGATAGAGGGAGCAAGAAGGGTCAGAGTGA
    GAGATGGAAGTAGGATATTGAGGAGAAAAAGAGAGAAAAAGGGAAGAGATGGAGAGAGAAACTAGGAGAC
    CCAGAGAGGGTCAGAGTTACACGGATGCGGGAGAGACAGAAAGGCAGAAGTCAAACGGGAAGACAGACGG
    AGGGTTTGGGAGCGAGATGGAGGCAGAAGAGGGCTGAAGAGCAACTGAAGGTGTCAACATTGGAAAAACC
    TCTCCAACGAAGGTGAAGCGTCGACGGAAAAGGTGAGACGGAGATGTGGGTGGGTAGGCTGTAGGGATGT
    CATCTGACTGAAGCCGCAACTGGGCGCCCAAATGGGCCAGAGACGCACACGTCTACTGCCCACGAGGGAA
    ACTAAGAGCGGGGGGCGGGGTTCGCCCCCGAGCCTCGGGGCCCAGCCGGACGCCTGGGTACCCGCGCGGG
    CGCCGACAGGGCGGGCCCAGGGTAGCCCCGCCCTGAGCTAGGGGTGAAGAGGGCGGGAGTCGCCGCCGTC
    GCGAGGGCGGGGACCGGACCTGCCTCGTCTCGCCCCAGGCTCAGCGCGCGATCCCCGCCCCGTAACCCTC
    CGCCCCCAACCCCGAAGCACAAGAAGGAAAGGGAAGGGAGGGCTAGGCAGCCGGACGCTGGGGTTTCCCC
    AGCCTCGCTGAGAGGAACTAGGAGCTTGGGGTCTACGCTCTCCGCAGAGCTCCGCGGGGTCCTCCTGTTC
    CTTCCGGAAGCGCAGGCTCCTCCCCCACACCCGCGCGTGGCACCCACGTGGGGCTTCTCCAACCCCTACA
    AGCTCGGTCTTTCCCCCGGGTCTCGCCGAGTCGCATTCACCCAGCTCTCTCCCTACTACGACTCCTCACT
    CAGCCCTCTTCCTTCCAGCCAGCGGCGAGAGGGTGGCGGGCCCTGCTGCTCCCAGCATGACACCATCCGT
    CGCTCCTCTACCCCATTCCAGGTCCACCTTTCCCACGCTTATCCTCCCGTTCTGTAAACCCCTTCCCACG
    ACCCAGTATTGTAGGTTTCCTGGGAGCGCGCGCTTCTTTCTCTGGGTTTCATCCTCTTACAGTCCTTGTG
    GGAAATATTAAAAGCACCTCCCGGCGCATTCTGGACACCCCCCGCCCCCACCCCCTGGGCACATCCTAGG
    GTCTCCGCTTCTCTCCCGCTAGTTTCCCGCACCCTACAATCTCGCGTCCCCTTCCGACCTCACATTTATC
    ACCCTCTCCTTCTAAGCCCTCCTCCAATCTCGCGTGTTCTTCGCGTCCTGTGCATGCGGGTCCACTCTCT
    CTACTTTCCTGGCACCCCTCTGGGATTCGCTTCTGTTTTTCTGTCCTTGAATCTTCCTGCCTCACGGCCC
    CTGAACTCTGAGTCAGCTTTCCCCACTACCTCTCCTTTTCCAAATGCCGGGGTGCTAGTTTCTCCCAAAG
    CGAGATCCCTCTCTGCAGCCCCGCTCCCACGACCCCCTGCATTCTCGAGCACCCTGCAAGGGGAAGTCTT
    TTTCGAATGGCTTCGCTTCTCTCACTCTAAGGGACTCCCCACACGATCTCGCATGATCCCGTCGCCCTCT
    AAAAGCGGTCCACTTCGCTCACTATCTCTTATTCAAGACCAGATACCTTGGGGTTAGGGAGCTCAGCGCT
    ATCTCTTTGGGACCCCTCCCCCCGACACGTTCCCGGCGCCCCCGGGGGTTCTCTTCCTCCAGCCAGTTTC
    CTCTACCAGCAGTTTCCTCCCCGTGACCCCTGCACTCCGGCGCCCCCTGGGGGCTCCCCTCCAGGGTCCC
    CTGCCCGTGCGAGCTCACTGTTGCCGTATTCCACCATTAGCACGCGGGTGACCTCCTTGGCGTAGTAGTC
    CGCCTCTGGCTCAGGCTCCGTTTCGGCACTTTCCCCGGCCACCCGGTCGCGGGTACTGTTGTAAAGGGCC
    AGTATGGCCTCGGGCAGCGGGCCGGGTGGCACATCCCCCTGGCTCGGGGGGCTGGCGAGCCGAAGCTTGG
    ACAAAATCTGGCCGCGGATGGCCTCGATGCGCTTCCGCTTCACCAGCTCCATGTCGATGGTCTTGCAGGT
    GGACAGTCCGGCGACCGGCCGGCCAGGCGTCAGCATTAGCAGCCACAGCAGCGGCAGCAGCAGCGGCAGC
    AGCCGCAGCCCCGAGGGCGGCATGGGGGAGGCGGCGCCCCCCGGCACAGCCGAGAGCGCGAGCTGGGCTG
    GGGTGGGAAGAGGGAGGCCCCGCCCCTACAGGGGCTGGGGTGGGTGGGGGTCTCCCGAGGAAAAGGTAGG
    AGGGTCTGTTTGCGGGGAGAGTTGAGGCCTTCAGGGAGAACGGAGCAGAGCTGGAGGGGAGGCTCTGATG
    GGTGGGTTCTCGGTATCCCACGGAAAAAAAACCGAGATGGGTGAGCTCTGGTACTAGAGATGGGTGATCT
    TGAATAGGAAAGCTGAGGCAAGTCTGAGAGAGATCCCGGATCCCGGAGAAGGGTCCTCGGATGCGCGGGG
    GCTCAGGAGAG
  • Protein Sequence : Show Sequence
    >gi|260655603|ref|NP_001159540.1| transforming growth factor beta-1 precursor [Bos taurus]
    MPPSGLRLLPLLLPLLWLLMLTPGRPVAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGDVPP
    GPLPEAILALYNSTRDRVAGESAETEPEPEADYYAKEVTRVLMVEYGNKIYDKMKSSSHSIYMFFNTSEL
    REAVPEPVLLSRADVRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLTR
    REEIEGFRLSAHCSCDSKDNTLQVDINGFSSGRRGDLATIHGMNRPFLLLMATPLERAQHLHSSRHRRAL
    DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGA
    SAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): Mycobacterium avium relA mutant vaccine
IV. Vaccine Information
1. M. avium DNA vaccine DNA-Av35/p2AIL12
a. Vaccine Ontology ID:
VO_0004540
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Antigen
M. avium 35,000 MW protein (Martin et al., 2003)
f. Vector:
pJW4303 (Martin et al., 2003)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Co-immunization with p2AIL-12 and DNA-Av35 led to a significant increase in the number of antigen-specific IFN-gamma secreting cells and total amount of IFN-gamma released, but a concomitant fall in the antibody response to the 35000 MW protein (Martin et al., 2003).
  • Efficacy: Immunization with DNA-Av35 resulted in significant protective immunity against M. avium infection with a 2-log10 reduction in the M. avium load in the spleen (P < 0.001). The addition of p2AIL12 to the DNA-Av35 vaccine significantly increased the level of protection in both the spleen (P < 0.005) and liver (P < 0.01), with a further reduction in the bacterial load of about 1-log10 (Martin et al., 2003).
2. Mycobacterium avium relA mutant vaccine
a. Vaccine Ontology ID:
VO_0002779
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Goat
e. Gene Engineering of relA
  • Type: Gene mutation
  • Description: This relA mutant is from Mycobacterium avium (Park et al., 2011).
  • Detailed Gene Information: Click here.
f. Immunization Route
Oral immunization
g. Goat Response
  • Persistence: A relA mutant is attenuated in goats (Park et al., 2011).
  • Efficacy: A relA mutant induces protection in goats from challenge with wild type M. avium (Park et al., 2011).
  • Host Gene Response of IFNG
    • Gene Response: Expression of IFN-gamma was increased. Specifically, a quantitative RT-PCR revealed the gene encoding IFN-γ was up-regulated in PBMC stimulated with live Map (a M. avium relA mutant) three months post infection compared to the response of PBMC pre-infection (Park et al., 2011).
    • Detailed Gene Information: Click here.
  • Host Gene Response of IL10
    • Gene Response: Expression of IL-10 was decreased. Specifically, a quantitative RT-PCR revealed the gene encoding IL-10 was down-regulated in PBMC stimulated with live Map (a M. avium relA mutant) three months post infection compared to the response of PBMC pre-infection (Park et al., 2011).
    • Detailed Gene Information: Click here.
  • Host Gene Response of IL17A
    • Gene Response: Expression of IL-17 was increased. Specifically, a quantitative RT-PCR revealed the gene encoding IL-17 was up-regulated in PBMC stimulated with live Map (a M. avium relA mutant) three months post infection compared to the response of PBMC pre-infection (Park et al., 2011).
    • Detailed Gene Information: Click here.
  • Host Gene Response of IL22
h. Cattle Response
  • Description: Cattle peripheral blood mononuclear cells (PBMC) were used for cytokine detection (Park et al., 2011).
  • Host Gene Response of IFNG
    • Gene Response: Expression of IFN-gamma was increased in cattle PBMC. Specifically, a quantitative RT-PCR revealed the gene encoding IFN-γ was up-regulated in PBMC stimulated with live Map (WT) three months post infection compared to the response of PBMC pre-infection (Park et al., 2011).
    • Detailed Gene Information: Click here.
  • Host Gene Response of IL17A
    • Gene Response: Expression of IL-17 was increased in cattle PBMC. Specifically, a quantitative RT-PCR revealed the gene encoding IL-17 was up-regulated in PBMC stimulated with live Map (WT) three months post infection compared to the response of PBMC pre-infection (Park et al., 2011).
    • Detailed Gene Information: Click here.
  • Host Gene Response of IL22
    • Gene Response: Expression of IL-22 was increased in cattle PBMC. Specifically, a quantitative RT-PCR revealed the gene encoding IL-22 was up-regulated in PBMC stimulated with live Map (WT) three months post infection compared to the response of PBMC pre-infection (Park et al., 2011).
    • Detailed Gene Information: Click here.
V. References
1. Martin et al., 2003: Martin E, Kamath AT, Briscoe H, Britton WJ. The combination of plasmid interleukin-12 with a single DNA vaccine is more effective than Mycobacterium bovis (bacille Calmette-Guèrin) in protecting against systemic Mycobacterim avium infection. Immunology. 2003; 109(2); 308-314. [PubMed: 12757627].
2. Park et al., 2011: Park KT, Allen AJ, Bannantine JP, Seo KS, Hamilton MJ, Abdellrazeq GS, Rihan HM, Grimm A, Davis WC. Evaluation of two mutants of Mycobacterium avium subsp. paratuberculosis as candidates for a live attenuated vaccine for Johne's disease. Vaccine. 2011; ; . [PubMed: 21565243].
3. WebMD - Mycobacterium avium complex: HIV, AIDS, and Mycobacterium Avium Complex [http://www.webmd.com/hiv-aids/guide/aids-hiv-opportunistic-infections-mycobacterium-avium-complex]