VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Burkholderia pseudomallei

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. FliC (Protective antigen)
    2. LolC/E (Protective antigen)
    3. LPS (Protective antigen)
    4. PotF (Protective antigen)
    5. aroC (Virmugen)
    6. asd (Virmugen)
    7. purM (Virmugen)
    8. purN (Virmugen)
  3. Vaccine Related Host Genes
    1. Ifng (Interferon gamma)
  4. Vaccine Information
    1. B. pseudomallei DNA vaccine encoding Flagellin Protein
    2. B. pseudomallei Subunit LolC Protein Vaccine
    3. B. pseudomallei Subunit PotF Protein Vaccine
    4. Burkholderia pseudomallei aroC deletion mutant vaccine
    5. Burkholderia pseudomallei asd mutant vaccine
    6. Burkholderia pseudomallei purM mutant vaccine
    7. Burkholderia pseudomallei purN mutant vaccine
  5. References
I. General Information
1. NCBI Taxonomy ID:
28450
2. Disease:
Melioidosis
3. Introduction
The bacterium Burkholderia pseudomallei is a gram-negative saprophytic bacillus that is found predominantly in Southeast Asia and tropical Australia and is the causative agent of the emerging infection melioidosis. Infection of humans with B. pseudomallei may occur by various routes, including via wounds and existing skin lesions, aspiration of contaminated water during near-drowning, and inhalation of organisms. The clinical manifestations of melioidosis are not uniform, and patients can present with pneumonia, skin abscesses, soft tissue abscesses, or osteomyelitis/septic arthritis. Pneumonic melioidosis is presented in over 50% of acute cases of the disease, and disseminated pneumonia is associated with high mortality. Chronic melioidosis usually occurs following acute melioidosis, and relapsing melioidosis can result from the reactivation of a latent B. pseudomallei infection, often due to the withdrawal of antibiotics or the failure to complete prescribed courses of antibiotics (Harland et al., 2007).
4. Microbial Pathogenesis
B. pseudomallei is an "accidental pathogen". It is an environmental organism that has no requirement to pass through an animal host in order to replicate. From the point of view of the bacterium, human infection is an evolutionary "dead end". B. pseudomallei is able to invade cells, polymerise actin and to spread from cell to cell, causing cell fusion and the formation of multinucleate giant cells (Wiki: B. pseudomallei).
5. Host Ranges and Animal Models
B. pseudomallei infects humans and animals and causes the disease melioidosis. It is also capable of infecting plants (Wiki: B. pseudomallei).
1. aroC
  • Gene Name : aroC
  • Sequence Strain (Species/Organism) : Burkholderia pseudomallei 1106a
  • NCBI Gene ID : 4899749
  • NCBI Protein GI : 126453136
  • Locus Tag : BURPS1106A_1713
  • Genbank Accession : CP000572
  • Protein Accession : YP_001065984
  • Taxonomy ID : 357348
  • Chromosome No : I
  • Gene Starting Position : 1672513
  • Gene Ending Position : 1673622
  • Gene Strand (Orientation) : +
  • Protein Name : chorismate synthase
  • Protein pI : 6.35
  • Protein Weight : 36184.83
  • Protein Length : 369
  • Protein Note : catalyzes the formation of chorismate from 5-O-(1-carboxyvinyl)-3-phosphoshikimate in aromatic amino acid biosynthesis
  • DNA Sequence : Show Sequence
    >gi|126451443:1672513-1673622 Burkholderia pseudomallei 1106a chromosome I, complete genome
    TATGTCCGGCAACACCCTCGGCACGCTTTTCACTGTCACGACCTTCGGCGAATCGCACGGCCCCGCGATC
    GGCTGCGTGATCGACGGCTGCCCGCCGGGCATGGCGCTCACGGAAGCCGACGTCCAGCTCGAGCTCGACC
    GCCGCAAGCCCGGCACGTCGCGCCACGTCACGCAGCGTCAGGAGCCCGACCAGGTCGAGATCCTGTCCGG
    CGTGTTCGAGGGCGTGACGACCGGCGCGCCGATCGCGCTCCTGATCCGCAACACCGACCAGCGCAGCAAG
    GACTACGGCAACATCGCCGAGACGTTCCGCCCGGGCCATGCCGATTACACCTACTGGCAAAAGTACGGCG
    TGCGCGACTATCGCGGCGGCGGCCGCTCGTCCGCGCGGCTGACGGCGCCCGTCGTCGGCGCCGGCGCGAT
    CGCGAAGAAGTGGCTGCGCGAGCGCTTCGGCGTCGAGGTGCGCGGCTACATGAGCGCGCTCGGCGAAATC
    GAGATCCCGTTCGTCGACTGGTCGCACGTGCGCGAGAACCCGTTCTTCGCGCCGAACGCCGACATCGTGC
    CGCAACTCGAGGGCTACATGGACGCGCTGCGCAAGGACGGCGATTCGATCGGCGCGCGCATCGATGTCGT
    CGCGTCGGGCGTGCCGGTCGGCTGGGGCGAGCCGCTGTTCGACCGGCTCGACGCCGACATCGCGCACGCG
    ATGATGGGGATCAACGCGGTGAAGGGCGTCGAGATCGGCGCGGGTTTCGCGAGCGTCGCGCAGCGCGGTT
    CGGTGCACGGCGACGAGCTGACGCCGGACGGCTTCGTCGGCAATCACGCGGGCGGCGTGCTCGGCGGCAT
    CTCGACGGGGCAGGACATCACGGTGTCGATCGCGATCAAGCCGACGTCGAGCATTCGCACGCCGCGCCGC
    TCGATCACGCGGGCGGGCGAACCCGCCGTCGTCGAGACGTTCGGCCGCCACGACCCGTGCGTCGGGATTC
    GCGCGACGCCGATCGCCGAATCGATGCTCGCGCTCGTGCTGATCGATCACGCGCTGCGGCACCGCGCGCA
    GTGCGGCGACGTGTCGAGCGCGACGCCGAGGATCGCCGCGCGCGCGCCGGACGCGCAATG
  • Protein Sequence : Show Sequence
    >gi|126453136|ref|YP_001065984.1| chorismate synthase [Burkholderia pseudomallei 1106a]
    MSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADVQLELDRRKPGTSRHVTQRQEPDQVEILSG
    VFEGVTTGAPIALLIRNTDQRSKDYGNIAETFRPGHADYTYWQKYGVRDYRGGGRSSARLTAPVVGAGAI
    AKKWLRERFGVEVRGYMSALGEIEIPFVDWSHVRENPFFAPNADIVPQLEGYMDALRKDGDSIGARIDVV
    ASGVPVGWGEPLFDRLDADIAHAMMGINAVKGVEIGAGFASVAQRGSVHGDELTPDGFVGNHAGGVLGGI
    STGQDITVSIAIKPTSSIRTPRRSITRAGEPAVVETFGRHDPCVGIRATPIAESMLALVLIDHALRHRAQ
    CGDVSSATPRIAARAPDAQ
  • Molecule Role : Virmugen
  • Molecule Role Annotation : The aroC deletion in the resultant mutant, designated A2ΔaroC, was confirmed by PCR, Southern hybridization and failure of the mutant to grow in a defined medium without aromatic compounds. The constructed unmarked aroC mutant of B. pseudomallei is attenuated in both BALB/c and C57Bl/6 mice and is able to confer significant protection in C57Bl/6 mice (Srilunchang et al., 2009).
  • Related Vaccine(s): Burkholderia pseudomallei aroC deletion mutant vaccine
2. asd
  • Gene Name : asd
  • Sequence Strain (Species/Organism) : Burkholderia pseudomallei 1026b
  • NCBI Protein GI : 2358232
  • Other Database IDs : CDD:200773
    CDD:162144
  • Taxonomy ID : 884204
  • Chromosome No : II
  • Gene Starting Position : 2291554
  • Gene Ending Position : 2292675
  • Gene Strand (Orientation) : -
  • Protein Name : aspartate beta-semialdehyde dehydrogenase
  • Protein pI : 5.09
  • Protein Weight : 37414.1
  • Protein Length : 90
  • Protein Note : Rossmann-fold NAD(P)(+)-binding proteins; cl09931
  • DNA Sequence : Show Sequence
    >gi|126455463:2291554-2292675 Burkholderia pseudomallei 1106a chromosome chromosome II, complete sequence
    TTTACTTGTCGAGCAGAATGCGCAGCATCCGGCGCAGCGGCTCGGCCGCGCCCCACAGCAATTGATCGCC
    GACGGTAAATGCCGACAGGTATTCGCCACCCATCGCGAGCTTGCGCAGGCGGCCGACCGGCACCGACAGC
    GTGCCCGTCACCTTCGCCGGCGACAGATCGCGCATCGACGCCTCGCGCTCGTTCGGCACGACCTTCACCC
    AGTCGTTCGCCGATGCGAGCATGCCGTTGATCTCGTCGAGCGGCACGTCCTTCTTCAGCTTGATCGTGAG
    CGCCTGCGAGTGGCAGCGCATCGCGCCGATCCGCACGCACAGGCCGTCGACCGGAATCGAGCCCGGCTCG
    CCCATCGCCGGCTTGCCGAGGATCTTGTTGGTTTCCGCGCCGCCCTTCCACTCTTCCTTCGACATGCCGT
    TGCCGAGATCCTTGTCGATCCACGGAATCAGCGAGCCGGCAAGCGGCACGCCGAACTGGCTCGTCGGCAT
    CGCGTCGCCGTTCATCGCGGCGAGCACGCGGCGGTCGATATCGAGGATCGCCGAGGCCGGATCGGCGAGC
    TGCGCCGCCACCGCGCCGTTGAGCGCGCCCATCTGCGCGAGCAGCTCGCGCATGTTCTGCGCGCCCGCGC
    CCGACGCGGCCTGGTAGGTCATCGCCGTCATCCAGTCGACGAGGTTCTCGCGGAACAGGCCGCCCAGCGC
    CATCAGCATCAGGCTGACCGTGCAGTTGCCGCCGATGAAGTTCTTCGTGCCGTTGACGAGCGCGTCCTTG
    ATCACGTTCAGGTTCACGGGATCGAGAATGATCACCGCGTCGTCCTTCATCCGCAGCGACGACGCCGCAT
    CGATCCAGTAGCCGTTCCAGCCGGCCGCGCGCAGCTTCGGGAACACGTCGCTCGTGTAATCGCCGCCCTG
    GCACGTGATGATCGCGTCGCACTTCTTCAGGTCGTCGATGCTCGTCGCATCCTTGAGCGTGGTCTCGTTT
    TTCGCGAACGACGGCGCCTTGCCGCCCGCGTTGCTGGTGCTGAAAAACACCGGCTCGATCAGATCGAAAT
    CGCCTTCTTCCTGCATGCGCTGCATCAGCACGCTGCCGACCATGCCGCGCCAACCTACGAGACCTACGTT
    CA
  • Protein Sequence : Show Sequence
    >gi|2358232|gb|AAB69093.1| aspartate beta-semialdehyde dehydrogenase [Burkholderia pseudomallei 1026b]
    CQGGDNASDVFPKPRAAGWNGYWIDAASSLRMKDDAVIILDPVNLNVIKDALVNGTKNFIGGNCTVSLML
    MALDGLFRENLVDWMTAMTY
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An asd mutant is highly attenuated in mice. This mutant was also able to protect against acute inhalation melioidosis caused by challenge with wild type B. pseudomallei (Norris et al., 2011).
  • Related Vaccine(s): Burkholderia pseudomallei asd mutant vaccine
3. FliC
  • Gene Name : FliC
  • VO ID : VO_0011303
  • NCBI Protein GI : 1929918
  • Other Database IDs : CDD:169576
    CDD:144315
    CDD:144340
  • Taxonomy ID : 28450
  • Gene Strand (Orientation) : ?
  • Protein Name : flagellin
  • Protein Length : 388
  • Protein Note : flagellin; Reviewed; PRK08869
  • Protein Sequence : Show Sequence
    >gi|1929918|gb|AAB51476.1| flagellin [Burkholderia pseudomallei]
    MLGINSNINSLVAQQNLNGSQGALSQAITRLSSGKRINSAADDAAGLAIATRMQTQINGLNQGVSNANDG
    VSILQTASSGLTSLTNSLQRIRQLAVQASNGPLSASDASALQQEVAQQISEVNRIASQTNYNGKNILDGS
    AGTLSFQVGANVGQTVSVDLTQSMSAAKIGGGMVQTGQTLGTIKVAIDSSGAAWSSGSTGQETTQINVVS
    DGKGGFTFTDQNNQALSSTAVTAVFGSSTAGTGTAASPSFQTLALSTSATSALSATDQANATAMVAQINA
    VNKPQTVSNLDISTQTGAYQAMVSIDNALATVNNLQATLGAAQNRFTAIATTQQAGSNNLAQAQSQIQSA
    DFAQETANLSRAQVLQQAGISVLAQANSLPQQVLKLLQ
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Flagellin encoding plasmid DNA was injected into Balb/c mice intramuscularly and this elicited both a humoral and a cellular immune response. Subsequent intravenous challenge of the vaccinated Balb/c mice with 105CFU of B. pseudomallei resulted in the number of bacterial cells detected in liver and/or spleen being significantly reduced in the flagellin plasmid DNA vaccinated mice. At 7 days subsequent to infection of B. pseudomallei, 5/6 (83%) of flagellin plasmid DNA vaccinated mice had survived (Chen et al., 2006).
  • Related Vaccine(s): B. pseudomallei DNA vaccine encoding Flagellin Protein
4. LolC/E
  • Gene Name : LolC/E
  • Sequence Strain (Species/Organism) : Burkholderia pseudomallei K96243
  • VO ID : VO_0010921
  • NCBI Gene ID : 3093214
  • NCBI Protein GI : 53719887
  • Locus Tag : BPSL2277
  • Genbank Accession : BX571965
  • Protein Accession : YP_108873
  • Taxonomy ID : 272560
  • Chromosome No : 1
  • Gene Starting Position : 2742869
  • Gene Ending Position : 2744122
  • Gene Strand (Orientation) : -
  • Protein Name : putative lipoprotein releasing system transmembrane protein
  • Protein pI : 9.43
  • Protein Weight : 41147.07
  • Protein Length : 417
  • Protein Note : Similar to Escherichia coli lipoprotein releasing system transmembrane protein LolE SWALL:LOLE_ECOLI (SWALL:P75958) (413 aa) fasta scores: E(): 1.3e-42, 34.54% id in 414 aa, and to Ralstonia solanacearum probable lipoprotein releasing system transmembrane rsc1117 or rs05757 SWALL:Q8Y0C7 (EMBL: AL646062) (416 aa) fasta scores: E(): 1.4e-112, 71.46% id in 417 aa
  • DNA Sequence : Show Sequence
    >gi|53717639:2742869-2744122 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
    GTCATTCATAGCGCAGCGCCTCCGCCGGGCGCACCTTCGCGCCGCGCCAGCTCGGATAGAGCGTCGCGAG
    CGCGGACAGCGCGAAAGCGATCACGCCGATCTTGATCACGTCGCCCGCGACGAGCTCGGACGGCAGCTCG
    CTGATGAAGTACACCGACGGCGGCAGGAACTGCACGCCGAACGCATGCTCGATCATCGGAATGAGCCACG
    GAATGCTCCACGCGATCAGGCAGCCGAGCGCGACGCCCGTCGCGGTCCCGACGAAGCCGATCGTCACGCC
    CTGCACGACGAAGATCTTCATGATCGAGCCCGGCTGCGCGCCGAGCGTGCGCAGGATCGCGATGTCCGCC
    TGCTTGTTCGTCACGGTCATCACGAGCGACGACACGAGATTGAACGCCGCGACCGCGATGATCAGCGTGA
    GGATGATGAACATCATCCGCTTCTCGATCTGCACCGCGGAGAACCACGTCTTGTTCTGCTGCGTCCAGTC
    GCGGATGTACAGGTCGCCCGACAGCGTGTGCGCGAGCTCGCGCGCGACCTGCGGCGCCTTCTGCATGTCC
    GTGAGGCGCAGCCGCACGCCCGTCGGCGCGGGCAGCCTGAAGAGCGCCTGCGCATCCTGGATGTCGATCA
    TCGCAAGCGTGCTGTCGTATTCGTAGTGCCCGGACTCGAAGATGCCGACCACCGTGAACTGCTTCAGGCG
    CGGCATCATCCCGGCCGGCGTGATCGTGCCTTCCGGCGCGACGAGCGTGACCTTGTCGCCGACGCCCACG
    CCGAGATTGCCCGCGAGCGCGTTGCCGAGCACGATCCCGAACTGGCCGGGCGCGAGCGCGGTGAGCGCGC
    CCGCCTTCATGTCCTTGCCGATGTCGGACACCTGCGGCTCGAGCGACGGCTCGACGCCGCGCAGCATCAC
    GCCGCTCACCGCGTCCTGCCGCGTGAGCAGCGCCTGCGCGTCGACATACGGCGCCGCGCCGATCACCGAG
    CGGTTCAGGCGCGCTTCCTTCGCGGTCAGTTGCCAGTCGGGCATCGAGCCCGTCGGCGAGAAGATCTCGA
    CGTGCGCGAGCACCGACAGCATCCGGTCGCGCACCTCTTTCTGGAAGCCGTTCATCACCGACAGCACGAC
    GATGAGCGCCGCGACGCCGAGCGCGATCCCGAGCATCGACACGAGCGCGATGAAGGAAATGAAGCCGTTG
    CCGGTCGTGCGTTTGCCGGCGCGCGTGTAGCGCCAGCCGATCTGCCATTCGTACGGGAGTTTCA
  • Protein Sequence : Show Sequence
    >gi|53719887|ref|YP_108873.1| putative lipoprotein releasing system transmembrane protein [Burkholderia pseudomallei K96243]
    MKLPYEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLSVLAHVE
    IFSPTGSMPDWQLTAKEARLNRSVIGAAPYVDAQALLTRQDAVSGVMLRGVEPSLEPQVSDIGKDMKAGA
    LTALAPGQFGIVLGNALAGNLGVGVGDKVTLVAPEGTITPAGMMPRLKQFTVVGIFESGHYEYDSTLAMI
    DIQDAQALFRLPAPTGVRLRLTDMQKAPQVARELAHTLSGDLYIRDWTQQNKTWFSAVQIEKRMMFIILT
    LIIAVAAFNLVSSLVMTVTNKQADIAILRTLGAQPGSIMKIFVVQGVTIGFVGTATGVALGCLIAWSIPW
    LIPMIEHAFGVQFLPPSVYFISELPSELVAGDVIKIGVIAFALSALATLYPSWRGAKVRPAEALRYE
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : LolC was evaluated as an antigen for a vaccine candidate against B. pseudomallei infection. Nonmembrane regions of the B. pseudomallei protein was expressed and purified from Escherichia coli and then evaluated as a vaccine candidate in an established mouse model of B. pseudomallei infection. When delivered with the monophosphoryl lipid A-trehalose dicorynomycolate adjuvant, the protein stimulated antigen-specific humoral and cellular immune responses. Immunization with the LolC protein domain afforded significant protection against a subsequent challenge with B. pseudomallei. LolC provided a greater level of protection when it was administered with immune-stimulating complexes complexed with CpG oligodeoxynucleotide 10103. Immunization with LolC also protected against a subsequent challenge with a heterologous strain of B. pseudomallei, demonstrating the potential utility of this protein as a vaccine antigen for melioidosis (Harland et al., 2007).
  • Related Vaccine(s): B. pseudomallei Subunit LolC Protein Vaccine
5. LPS
  • Gene Name : LPS
  • Gene Strand (Orientation) : ?
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : LPS or capsular polysaccharide was used to immunize BALB/c mice. The different polysaccharide antigens induced antibody responses. Mice vaccinated with LPS developed predominantly IgM and IgG3 responses. Contrastingly, mice vaccinated with capsular polysaccharide developed a predominantly IgG2b response. After immunization, mice were challenged by the intra-peritoneal route and an increased mean time to death was observed compared with unvaccinated controls. Immunization with LPS provided an optimal protective response. Mice challenged by the aerosol route showed a small increase in the mean time to death compared with the unvaccinated controls. The passive transfer of antigen from immunized into naive mice provided protection against a subsequent challenge (Nelson et al., 2004).
6. PotF
  • Gene Name : PotF
  • Sequence Strain (Species/Organism) : Burkholderia pseudomallei K96243
  • VO ID : VO_0010922
  • NCBI Gene ID : 3095748
  • NCBI Protein GI : 53721504
  • Locus Tag : BPSS0467
  • Genbank Accession : BX571966
  • Protein Accession : YP_110489
  • Taxonomy ID : 272560
  • Chromosome No : 2
  • Gene Starting Position : 636534
  • Gene Ending Position : 637655
  • Gene Strand (Orientation) : -
  • Protein Name : putrescine ABC transport system, binding exported protein
  • Protein pI : 6.89
  • Protein Weight : 37606.43
  • Protein Length : 373
  • Protein Note : Similar to Escherichia coli putrescine-binding periplasmic protein precursor PotF or b0854 SWALL:POTF_ECOLI (SWALL:P31133) (370 aa) fasta scores: E(): 3.3e-67, 49.3% id in 357 aa, and to Pseudomonas aeruginosa polyamine transport protein pa0301 SWALL:Q9I6J0 (EMBL: AE004468) (365 aa) fasta scores: E(): 6.3e-69, 49.59% id in 367 aa. Possible alternative translational start site
  • DNA Sequence : Show Sequence
    >gi|53721039:636534-637655 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
    ATCAGTGTCCCGTCTTCAATTGCGCCCACAGACGGTTCTCGAGCCGCAGGATGTCGGCGGGCATCGGCCG
    CATCAGCGTCATCTTCTTGAGCACGTCCTCGGGCGGGTAGACGGTCGGGTCCTGCGCGACGGCGGGCACG
    ACGAACTGTCGCGCCGCGCGGTTCGCGCTCGGGTAGAACACTTCGTTGGTGATCGCCGCGTTGACCTTCG
    GGTCCTCGATGTAGTTGATCCACTTCAGCGCGGCTTCCGCGTGCGGCGCATCCTTCGGGATCACCATCAC
    GTCGAACCACAGCAGGCCGCCTTCCTTCGGATTCGAGAACTTGATGTCGTACGGGCGCTTCGCCTCGGCC
    GAGCGGCGATGCGCGATGCCGACGTCGCCCGACCAGCCGAGCGCGACGCATACGTCGTTGTTCGCGAGAT
    CGTTGATGTAGCCGGACGAGTTGAATTGCGTGATGTACGGGCGGACTTTCTTCAGCACCTCGAACGCCGC
    CTGGTAATCGGCCGGGTTCGTGCTGTTCGGATTCCTGCCCATGTATTGTAGCGTCGCGGCGAACACGTCG
    ACCGCCTGATCGAGGAACGATACGCCGCAGCCCTTGAGCTTGGATACGTTCGCCGGATCGAGCACGAGCG
    CCCAGCTGTCGACGGGCGCGTTCTCGCCGAGCGCCTTCTTCACCGCCTGCACGTTGTAGCCGAGGCCGTC
    GGTGCCGAACGCCCACGGCACGCCGTACTGGTTGCCCGGATCGGCGTCGGCGATCATCTTCATCAGCGTC
    GGATCGAGGTTCGACAGGTTCGGCAGCTTCGATTTGTCGAGCTTCTGGTAGACGCCCGCCTGAATCTGCT
    TGGCCATGTAGTTCGACGTCGGCACGACGATGTCGTAGCCGGAGCTGCCCGCGAGCAGCTTCGCCTGCAG
    CGTGTCGTCGCTGTCGTAGTTGTCGTACTTGACGTGGATGCCGGATTGCTTCTCGAAGTTCGGGATCGTG
    TCCTTCGCGATGTAGTCCGACCAGTTGTACACGTTCAGCTCGGCGCCGGCCGCGTGCGCGGCCGGCAGGG
    CGAGCGCCGACGCGCCGGCGAGCGCGACGAGCGCTGCGCGCGCGACCGCATGACGAAGATGGCTCACACT
    CA
  • Protein Sequence : Show Sequence
    >gi|53721504|ref|YP_110489.1| putrescine ABC transport system, binding exported protein [Burkholderia pseudomallei K96243]
    MSVSHLRHAVARAALVALAGASALALPAAHAAGAELNVYNWSDYIAKDTIPNFEKQSGIHVKYDNYDSDD
    TLQAKLLAGSSGYDIVVPTSNYMAKQIQAGVYQKLDKSKLPNLSNLDPTLMKMIADADPGNQYGVPWAFG
    TDGLGYNVQAVKKALGENAPVDSWALVLDPANVSKLKGCGVSFLDQAVDVFAATLQYMGRNPNSTNPADY
    QAAFEVLKKVRPYITQFNSSGYINDLANNDVCVALGWSGDVGIAHRRSAEAKRPYDIKFSNPKEGGLLWF
    DVMVIPKDAPHAEAALKWINYIEDPKVNAAITNEVFYPSANRAARQFVVPAVAQDPTVYPPEDVLKKMTL
    MRPMPADILRLENRLWAQLKTGH
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : PotF was evaluated as an antigen for a vaccine candidate against B. pseudomallei infection. Nonmembrane regions of the B. pseudomallei protein was expressed and purified from Escherichia coli and then evaluated as a vaccine candidate in an established mouse model of B. pseudomallei infection. When delivered with the monophosphoryl lipid A-trehalose dicorynomycolate adjuvant, the protein stimulated antigen-specific humoral and cellular immune responses. Immunization with the PotF protein domain afforded significant protection against a subsequent challenge with B. pseudomallei (Harland et al., 2007).
  • Related Vaccine(s): B. pseudomallei Subunit PotF Protein Vaccine
7. purM
  • Gene Name : purM
  • Sequence Strain (Species/Organism) : Burkholderia pseudomallei K96243
  • NCBI Gene ID : 3092877
  • NCBI Protein GI : 53720427
  • Locus Tag : BPSL2818
  • Genbank Accession : BX571965
  • Protein Accession : YP_109413
  • Taxonomy ID : 272560
  • Chromosome No : 1
  • Gene Starting Position : 3369942
  • Gene Ending Position : 3370997
  • Gene Strand (Orientation) : -
  • Protein Name : phosphoribosylaminoimidazole synthetase
  • Protein pI : 4.98
  • Protein Weight : 33766.88
  • Protein Length : 351
  • Protein Note : Also known as purGcatalyzes the formation of 1-(5-phosphoribosyl)-5-aminoimidazole from 2-(formamido)-N1-(5-phosphoribosyl)acetamidine and ATP in purine biosynthesis
  • DNA Sequence : Show Sequence
    >gi|53717639:3369942-3370997 Burkholderia pseudomallei K96243 chromosome chromosome 1, complete sequence
    GTCAGACCACGACCGTCTGCGCCTCGCCTTCGCGGCTCGCGCGCACGGTGCCGATCTTCCATACCTGCTC
    GCCCGCGTCGGCCAGTTGGCGGAGCGCGTCGTCCGCGTCGGCGGCCGACACGATCACGGCCATCCCGATC
    CCGCAGTTGAACACGCGGTGCATCTCCGCATCGGCGACGCCGCCGTGCTGCCGCAGCCACTGGAACAGCG
    GCGGCAGCGGCCATGCGTGCTGGTCGAGTTCGGCCGTGAGGCCGTCGCGCAGCACGCGCGGAATGTTCTC
    GACGAGGCCGCCGCCCGTGATGTGCGCCATTCCCTTCACCGCGATCTTCTCCATCAGCGCGAGGAGCGGC
    TTCACGTAGATGCGCGTCGGCGCCATCAGCGCGTCGGCGAGCGAGCGGCCGTGGAAATCGGCCGACAGGT
    CCGGATTCGCGCGCTCGATGATCTTGCGCACGAGCGAGAAACCGTTCGAATGGATGCCGCTCGACGCGAG
    GCCCAGCACGACGTCGCCCTCGGCGATCGTGCTGCCGTCAATGATCTTGCTCTTCTCGACCGCGCCGACC
    GCGAAGCCCGCCAGATCGTATTCGCCGTCCGGGTACATGCCCGGCATCTCGGCCGTCTCGCCGCCGATCA
    GCGCGCAGCCCGCCAGCTCGCAGCCCGTCGCGATGCCCTTGACGACGGTCGCGGCCGTCTCGACGTCGAG
    CTTGCCGCACGCGAAGTAGTCGAGGAAGAACAGCGGCTCGGCGCCCTGCACGAGAATGTCGTTTACGCTC
    ATCGCGACGAGATCCTGGCCGACCGTATCGTGTTTGTTCAGATGAAACGCGAGCTTGAGCTTCGTGCCGA
    CGCCGTCCGTGCCCGATACGAGCACGGGCTCCCGGTACTTCTTCGGCACCTCGAACAGCGCGCCGAACCC
    GCCGATGCCGCCGAGCACGCCGTCGCGCAGCGTTTTCTTCGCAAAGGGCTTGATCTTGTCGACGAGCGCG
    TCGCCCGCGTCGATGTCGACGCCCGCGTCACGGTAGGACAGGCCCTGGGCGTCGGGAGCGGATTTCGGAG
    GATTCA
  • Protein Sequence : Show Sequence
    >gi|53720427|ref|YP_109413.1| phosphoribosylaminoimidazole synthetase [Burkholderia pseudomallei K96243]
    MNPPKSAPDAQGLSYRDAGVDIDAGDALVDKIKPFAKKTLRDGVLGGIGGFGALFEVPKKYREPVLVSGT
    DGVGTKLKLAFHLNKHDTVGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVETAATVVKGIATGCELAG
    CALIGGETAEMPGMYPDGEYDLAGFAVGAVEKSKIIDGSTIAEGDVVLGLASSGIHSNGFSLVRKIIERA
    NPDLSADFHGRSLADALMAPTRIYVKPLLALMEKIAVKGMAHITGGGLVENIPRVLRDGLTAELDQHAWP
    LPPLFQWLRQHGGVADAEMHRVFNCGIGMAVIVSAADADDALRQLADAGEQVWKIGTVRASREGEAQTVV
    V
  • Molecule Role : Virmugen
  • Molecule Role Annotation : Mice that were challenged with a higher dose of mutant 56:65 purM were protected (Breitbach et al., 2008).
  • Related Vaccine(s): Burkholderia pseudomallei purM mutant vaccine
8. purN
  • Gene Name : purN
  • Sequence Strain (Species/Organism) : Burkholderia pseudomallei K96243
  • NCBI Gene ID : 3092878
  • NCBI Protein GI : 53718549
  • Locus Tag : BPSL0908
  • Genbank Accession : BX571965
  • Protein Accession : YP_107535
  • Taxonomy ID : 272560
  • Chromosome No : 1
  • Gene Starting Position : 1060390
  • Gene Ending Position : 1061052
  • Gene Strand (Orientation) : ?
  • Protein Name : phosphoribosylglycinamide formyltransferase
  • Protein pI : 6.08
  • Protein Weight : 21138.36
  • Protein Length : 220
  • Protein Note : glycinamide ribonucleotide transformylase; GAR Tfase; catalyzes the synthesis of 5'-phosphoribosylformylglycinamide from 5'-phosphoribosylglycinamide and 10-formyltetrahydrofolate; PurN requires formyl folate for the reaction unlike PurT which uses formate
  • DNA Sequence : Show Sequence
    >gi|53717639:1060390-1061052 Burkholderia pseudomallei K96243 chromosome chromosome 1, complete sequence
    GATGAAAAAACTTGTCATCCTGATTTCCGGCCGCGGCAGCAACATGGAGGCCATCGTACGCGCCTGCGCG
    CGCGAAGGCTGGCCCGCCGAGGTCGCCGCCGTGATTTCCAACCGGCCGGGCGCGGCCGGCCTCGAATTCG
    CGGCGTCGCACGGCATCGCGACGGCCGTCGTCGACCACCGCGCGTTCGACGGCCGCGACAGCTTCGATGC
    GGCGCTCGCCGCCGAAATCGACCGCTTCGCCCCCGATCTCGTCGTGCTCGCCGGCTTCATGCGCATTCTC
    ACGCCGGCGTTCGTCGCCAAATATGAGGGGCGGATGCTCAACATCCATCCGTCGCTGCTGCCGAGCTTCA
    AGGGCATTCATACGCATCAGCAGGCGCTCGACGCGGGCGTCGCGCTGCACGGCGCATCCGTCCACTTCGT
    GATTCCGGAGCTCGACAGCGGCGCGATCGTCGCGCAGGCGGCCGTGCCCGTCGTCGCGGGCGACGATGCC
    GATGCGCTCGCCGCGCGCGTGCTCGCCGCCGAGCACACGCTGTATCCGCGCGCGGTGCGCTGGTTCGTCG
    AAGGCAAGCTGCGCCTCGACGCGGGGCGCGCCATCGTCGCGCCCGACGAGGCGCGCTGGCTGTTCGCGGA
    TGCGATCGACACGTCGACGAGCGAGGGCGTATG
  • Protein Sequence : Show Sequence
    >gi|53718549|ref|YP_107535.1| phosphoribosylglycinamide formyltransferase [Burkholderia pseudomallei K96243]
    MKKLVILISGRGSNMEAIVRACAREGWPAEVAAVISNRPGAAGLEFAASHGIATAVVDHRAFDGRDSFDA
    ALAAEIDRFAPDLVVLAGFMRILTPAFVAKYEGRMLNIHPSLLPSFKGIHTHQQALDAGVALHGASVHFV
    IPELDSGAIVAQAAVPVVAGDDADALAARVLAAEHTLYPRAVRWFVEGKLRLDAGRAIVAPDEARWLFAD
    AIDTSTSEGV
  • Molecule Role : Virmugen
  • Molecule Role Annotation : Although 30:93a purN -immunized mice were challenged with a 10-fold higher dose of WT E8, mice were strongly protected and showed no signs of clinical illness until the experiment was terminated (Breitbach et al., 2008).
  • Related Vaccine(s): Burkholderia pseudomallei purN mutant vaccine
1. Ifng (Interferon gamma)
  • Gene Name : Ifng (Interferon gamma)
  • Sequence Strain (Species/Organism) : Mouse
  • NCBI Gene ID : 15978
  • NCBI Protein GI : 33468859
  • Genbank Accession : NM_008337
  • Protein Accession : NP_032363.1
  • Other Database IDs : MGI:107656; UniProt: P01580
  • Taxonomy ID : 10090
  • Gene Strand (Orientation) : ?
  • DNA Sequence : Show Sequence
    >gi|145966741|ref|NM_008337.3| Mus musculus interferon gamma (Ifng), mRNA
    ATAGCTGCCATCGGCTGACCTAGAGAAGACACATCAGCTGATCCTTTGGACCCTCTGACTTGAGACAGAA
    GTTCTGGGCTTCTCCTCCTGCGGCCTAGCTCTGAGACAATGAACGCTACACACTGCATCTTGGCTTTGCA
    GCTCTTCCTCATGGCTGTTTCTGGCTGTTACTGCCACGGCACAGTCATTGAAAGCCTAGAAAGTCTGAAT
    AACTATTTTAACTCAAGTGGCATAGATGTGGAAGAAAAGAGTCTCTTCTTGGATATCTGGAGGAACTGGC
    AAAAGGATGGTGACATGAAAATCCTGCAGAGCCAGATTATCTCTTTCTACCTCAGACTCTTTGAAGTCTT
    GAAAGACAATCAGGCCATCAGCAACAACATAAGCGTCATTGAATCACACCTGATTACTACCTTCTTCAGC
    AACAGCAAGGCGAAAAAGGATGCATTCATGAGTATTGCCAAGTTTGAGGTCAACAACCCACAGGTCCAGC
    GCCAAGCATTCAATGAGCTCATCCGAGTGGTCCACCAGCTGTTGCCGGAATCCAGCCTCAGGAAGCGGAA
    AAGGAGTCGCTGCTGATTCGGGGTGGGGAAGAGATTGTCCCAATAAGAATAATTCTGCCAGCACTATTTG
    AATTTTTAAATCTAAACCTATTTATTAATATTTAAAACTATTTATATGGAGAATCTATTTTAGATGCATC
    AACCAAAGAAGTATTTATAGTAACAACTTATATGTGATAAGAGTGAATTCCTATTAATATATGTGTTATT
    TATAATTTCTGTCTCCTCAACTATTTCTCTTTGACCAATTAATTATTCTTTCTGACTAATTAGCCAAGAC
    TGTGATTGCGGGGTTGTATCTGGGGGTGGGGGACAGCCAAGCGGCTGACTGAACTCAGATTGTAGCTTGT
    ACCTTTACTTCACTGACCAATAAGAAACATTCAGAGCTGCAGTGACCCCGGGAGGTGCTGCTGATGGGAG
    GAGATGTCTACACTCCGGGCCAGCGCTTTAACAGCAGGCCAGACAGCACTCGAATGTGTCAGGTAGTAAC
    AGGCTGTCCCTGAAAGAAAGCAGTGTCTCAAGAGACTTGACACCTGGTGCTTCCCTATACAGCTGAAAAC
    TGTGACTACACCCGAATGACAAATAACTCGCTCATTTATAGTTTATCACTGTCTAATTGCATATGAATAA
    AGTATACCTTTGCAACC
  • Protein Sequence : Show Sequence
    >gi|33468859|ref|NP_032363.1| interferon gamma [Mus musculus]
    MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQI
    ISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQ
    LLPESSLRKRKRSRC
  • Molecule Role Annotation : IFN-gamma plays a critical role in Th1 type immune response. It is important for protection against infections by various viruses and intracellular bacteria.
  • Additional Molecule Role : Vaximmutor
  • Additional Molecule Role Annotation : The experimental data demonstrated that three time vaccinations with BCG in BALB/c mice induced strong TB Ag-specific IFN-gamma immune responses in splenocytes (Wang et al., 2009).
  • Related Vaccine(s): B. pseudomallei DNA vaccine encoding Flagellin Protein
IV. Vaccine Information
1. B. pseudomallei DNA vaccine encoding Flagellin Protein
a. Vaccine Ontology ID:
VO_0011538
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of FliC
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Adjuvant: complete Freunds adjuvant
f. Vector:
pcDNA3 (Chen et al., 2006)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: Balb/c
  • Vaccination Protocol: Six-week-old female Balb/c mice from groups 1–3 were injected intramuscularly (i.m.) with pcDNA3/fliC in PBS (50, 100 or 150 μg); whereas those from group 4 (the negative control) were injected (i.m) with vector DNA(150 μg; pcDNA3) in PBS, whilst those from group 5 (the positive control) were injected subcutaneously with recombinant flagellin antigens (50 μg) emulsified in complete Freund's adjuvant. Each animal from group 5 was subsequently boosted with the same dose of flagellin in incomplete Freund's adjuvant 14 days subsequent to the initial flagellin injection. The animals in groups 1–4 were boosted twice with an identical dose of plasmid DNA, once at 7 days and then again at 14 days after the initial injection (Chen et al., 2006).
  • Challenge Protocol: The immunized mice were infected via the tail vein with 105 CFU of mixed B. pseudomallei suspended in sterile PBS (50 μl). As control groups, the mice received either sterile PBS or vector DNA (Chen et al., 2006).
  • Efficacy: Subsequent intravenous challenge of the vaccinated Balb/c mice with 10(5)CFU of B. pseudomallei resulted in the number of bacterial cells detected in liver and/or spleen being significantly reduced in the flagellin plasmid DNA vaccinated mice. At 7 days subsequent to infection of B. pseudomallei, 5/6 (83%) of flagellin plasmid DNA vaccinated mice had survived (Chen et al., 2006).
  • Host Gene Response of Ifng (Interferon gamma)
    • Gene Response: Mice spleen cells were collected after an eight-week immunization. The up-regulation of IFN-γ production among the mice immunized with pcDNA3/fliC was significantly greater than among the mice either immunized with recombinant flagellin or vaccinated with vector DNA only (Chen et al., 2006).
    • Detailed Gene Information: Click here.
2. B. pseudomallei Subunit LolC Protein Vaccine
a. Vaccine Ontology ID:
VO_0011436
b. Type:
Subunit vaccine
c. Status:
Research
d. Gene Engineering of LolC/E
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
e. Immunization Route
Intraperitoneal injection (i.p.)
f. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Female 5- to 6-week-old BALB/c mice were immunized with the purified recombinant LolC protein given with adjuvant (Harland et al., 2007).
  • Challenge Protocol: Mice immunized with the LolC protein or appropriate controls were challenged with B. pseudomallei K96243 on day 70 (Harland et al., 2007).
  • Efficacy: The recombinant LolC protein afforded significant protection against the B. pseudomallei challenge (Harland et al., 2007).
3. B. pseudomallei Subunit PotF Protein Vaccine
a. Vaccine Ontology ID:
VO_0011438
b. Type:
Subunit vaccine
c. Status:
Research
d. Gene Engineering of PotF
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
e. Immunization Route
Intraperitoneal injection (i.p.)
f. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Female 5- to 6-week-old BALB/c mice were immunized with the purified recombinant PotF protein given with adjuvant (Harland et al., 2007).
  • Challenge Protocol: Mice immunized with the PotF protein or appropriate controls were challenged with B. pseudomallei K96243 on day 70 (Harland et al., 2007).
  • Efficacy: Immunization with the PotF protein domain afforded significant protection against a subsequent challenge with B. pseudomallei (Harland et al., 2007).
4. Burkholderia pseudomallei aroC deletion mutant vaccine
a. Vaccine Ontology ID:
VO_0002825
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Gene Engineering of aroC
  • Type: Gene mutation
  • Description:
  • Detailed Gene Information: Click here.
e. Preparation
An unmarked aroC deletion mutant of B. pseudomallei strain A2 was constructed using a sucrose counter-selection strategy. The aroC deletion in the resultant mutant, designated A2DeltaaroC, was confirmed by PCR, Southern hybridization and failure of the mutant to grow in a defined medium without aromatic compound (Srilunchang et al., 2009).
f. Immunization Route
Intraperitoneal injection (i.p.)
g. Mouse Response
  • Persistence: Compared to the parental wild type strain, A2DeltaaroC was highly attenuated for virulence following intraperitoneal introduction into BALB/c and C57BL/6 mice (Srilunchang et al., 2009).
  • Efficacy: C57BL/6 mice immunized intraperitoneally with A2DeltaaroC were significantly protected against a challenge dose of 6,000 cfu (20 x LD50) (Srilunchang et al., 2009).
5. Burkholderia pseudomallei asd mutant vaccine
a. Vaccine Ontology ID:
VO_0002826
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of asd
  • Type: Gene mutation
  • Description: This asd mutant is from Burkholderia pseudomallei (Norris et al., 2011).
  • Detailed Gene Information: Click here.
f. Immunization Route
intranasal immunization
g. Mouse Response
  • Persistence: An asd mutant is highly attenuated in mice (Norris et al., 2011).
  • Efficacy: An asd mutant induces protection against challenge with wild type B. pseudomallei (Norris et al., 2011).
6. Burkholderia pseudomallei purM mutant vaccine
a. Vaccine Ontology ID:
VO_0002827
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of purM
f. Immunization Route
Intraperitoneal injection (i.p.)
g. Mouse Response
7. Burkholderia pseudomallei purN mutant vaccine
a. Vaccine Ontology ID:
VO_0002828
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of purN
f. Immunization Route
Intraperitoneal injection (i.p.)
g. Mouse Response
  • Persistence: A purN mutant was attenuated in mice, as mice did not show any clinical symptoms of illness (Breitbach et al., 2008).
  • Efficacy: A purN induced strong protection in mice from challenge with wild type B. pseudomallei (Breitbach et al., 2008).
V. References
1. Breitbach et al., 2008: Breitbach K, Köhler J, Steinmetz I. Induction of protective immunity against Burkholderia pseudomallei using attenuated mutants with defects in the intracellular life cycle. Transactions of the Royal Society of Tropical Medicine and Hygiene. 2008; 102 Suppl 1; S89-94. [PubMed: 19121696].
2. Chen et al., 2006: Chen YS, Hsiao YS, Lin HH, Yen CM, Chen SC, Chen YL. Immunogenicity and anti-Burkholderia pseudomallei activity in Balb/c mice immunized with plasmid DNA encoding flagellin. Vaccine. 2006; 24(6); 750-758. [PubMed: 16169637].
3. Harland et al., 2007: Harland DN, Chu K, Haque A, Nelson M, Walker NJ, Sarkar-Tyson M, Atkins TP, Moore B, Brown KA, Bancroft G, Titball RW, Atkins HS. Identification of a LolC homologue in Burkholderia pseudomallei, a novel protective antigen for melioidosis. Infection and immunity. 2007; 75(8); 4173-4180. [PubMed: 17517877].
4. Nelson et al., 2004: Nelson M, Prior JL, Lever MS, Jones HE, Atkins TP, Titball RW. Evaluation of lipopolysaccharide and capsular polysaccharide as subunit vaccines against experimental melioidosis. Journal of medical microbiology. 2004; 53(Pt 12); 1177-1182. [PubMed: 15585494].
5. Norris et al., 2011: Norris MH, Propst KL, Kang Y, Dow SW, Schweizer HP, Hoang TT. The Burkholderia pseudomallei {Delta}asd mutant exhibits attenuated intracellular infectivity and imparts protection against acute inhalation melioidosis in mice. Infection and immunity. 2011; ; . [PubMed: 21807903].
6. Srilunchang et al., 2009: Srilunchang T, Proungvitaya T, Wongratanacheewin S, Strugnell R, Homchampa P. Construction and characterization of an unmarked aroC deletion mutant of Burkholderia pseudomallei strain A2. The Southeast Asian journal of tropical medicine and public health. 2009; 40(1); 123-130. [PubMed: 19323044].
7. Wiki: B. pseudomallei: Wiki: B. pseudomallei [http://en.wikipedia.org/wiki/Burkholderia_pseudomallei]