VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Dengue Virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. 18H6 synthetic E protein (Protective antigen)
    2. E protein (Protective antigen)
    3. E protein from Dengue 1 (Protective antigen)
    4. E protein from Dengue 3 (Protective antigen)
    5. E protein from Dengue 4 (Protective antigen)
    6. M protein (Protective antigen)
    7. NS1 (Protective antigen)
    8. PrM (Protective antigen)
    9. prM from Dengue 1 (Protective antigen)
    10. prM from Dengue 2 (Protective antigen)
    11. prM from Dengue 3 (Protective antigen)
  3. Vaccine Related Host Genes
    1. Il12a
  4. Vaccine Information
    1. CAdVax-Den12/Den34
    2. Dengue DNA Vaccine encoding NS1 Protein
    3. Dengue Subunit E Protein Vaccine
    4. Dengue Vaccine using Vaccinia Virus expressing M Protein
    5. Dengue Vaccine using Vaccinia Virus expressing prM Protein
    6. Dengue virus DNA vaccine 1040D2MEL encoding dengue-2 prM-E-LAMP chimeric protein
    7. Dengue virus DNA vaccine D1ME encoding prM and E
    8. Dengue Virus DNA Vaccine D1ME-VRP
    9. Dengue Virus DNA Vaccine encoding NS1
    10. Dengue Virus DNA Vaccine expressing prM/E proteins
    11. Dengue virus DNA vaccine p1012D2ME encoding prM and E from DEN 2 New Guinea C strain
    12. Dengue virus DNA vaccine pcTPANS1 encoding NS1 fused to the tissue plasminogen activator signal sequence
    13. Dengue virus DNA vaccine pE1D2 encoding E from Dengue Virus 2 strain New Guinea C
    14. Dengue virus DNA vaccine sA encoding prM and E from Dengue Virus 4
    15. Dengue virus DNA vaccine sABC encoding prM and E
    16. Dengue virus DNA vaccine sB encoding E
    17. Dengue virus DNA vaccine sC encoding prM and E
  5. References
I. General Information
1. NCBI Taxonomy ID:
12637
2. Disease:
Dengue Fever
3. Introduction
Dengue (DEN) viruses belong to the family Flaviviridae and consist of four distinct antigenic serotypes, DEN1–4. DEN viruses are transmitted primarily by the mosquito Aedes aegypti and cause over 100 million human infections per year, which are manifested clinically by either DEN fever (DF), a self-limited febrile illness, or more severe DEN hemorrhagic fever/DEN shock syndrome (DHF/DSS) usually with a mortality that ranges from 1 to 5%. Epidemic DF/DHF has been emerging as one of the most important global public health problems in the tropical and subtropical countries at the beginning of the 21st century. It is imperative to support research on the development of new mosquito control technology and on the establishment of preventive strategies, including the development of effective and safe dengue vaccines (Liu et al., 2006).
4. Microbial Pathogenesis
During the feeding of mosquitoes on humans, DENV is presumably injected into the bloodstream, with spillover in the epidermis and dermis, resulting in infection of immature Langerhans cells (epidermal dendritic cells [DC]), and keratinocytes. Infected cells then migrate from site of infection to lymph nodes, where monocytes and macrophages are recruited, which become targets of infection. Consequently, infection is amplified and virus is disseminated through the lymphatic system. As a result of this primary viremia, several cells of the mononuclear lineage, including blood-derived monocytes, myeloid DC, and splenic and liver macrophages are infected (Martina et al., 2009).
5. Host Ranges and Animal Models
Dengue is transmitted to humans by Aedes mosquitoes, mainly Aedes aegypti. There is no animal model of disease that mimics the disease in humans (Martina et al., 2009).
6. Host Protective Immunity
In most acute virus infection models, the presence of antibodies, both neutralizing and nonneutralizing, correlates with control, elimination, and eventually protection (Martina et al., 2009).
1. 18H6 synthetic E protein
  • Gene Name : 18H6 synthetic E protein
  • Sequence Strain (Species/Organism) : synthetic construct
  • NCBI Nucleotide GI : 73915390
  • NCBI Protein GI : 73915391
  • Protein Accession : AAZ92557.1
  • Taxonomy ID : 32630
  • Gene Strand (Orientation) : ?
  • Protein Name : chimeric Dengue envelope antigen 18H6
  • Protein Note : derived from Dengue virus
  • DNA Sequence : Show Sequence
    >gi|73915390|gb|DQ158253.1| Synthetic construct chimeric Dengue envelope antigen 18H6 mRNA, partial cds
    ATGGTGGTGATCTTCATCCTGCTGATGCTGGTGACCCCCTCCATGACAATGAGGTGCGTGGGCGTGGGCA
    ACAGGGACTTCGTGGAGGGCCTGAGCGGCGCCACCTGGGTGGACGTGGTGCTGGAGCACGGCGGCTGCGT
    GACCACCATGGCCAAGAACAAGCCCACCCTGGACTTCGAGCTGATCAAGACCACCGCCAAGGAGGTGGCC
    CTGCTGAGGACCTACTGCATCGAGGCCAGCATCAGCAACATCACCACCGCCACCAGGTGCCCCACCCAGG
    GCGAGGCCATCCTGCCCGAGGAGCAGGACCAGAACTACGTGTGCAAGCACACCTACGTGGACAGGGGCTG
    GGGCAACGGCTGCGGCCTGTTCGGCAAGGGCAGCCTGGTGACCTGCGCCAAGTTCACCTGCAAGAAGAAC
    ATGGAGGGCAACATCGTGCAGCCCGAGAACCTGGAGTACACCATCGTGATCACCCCCCACACCGGCGACC
    AGCACCAGGTGGGCAACGACACCCAGGGCGTGACCGTGGAGATCACCCCCCAGGCCAGCACCGTGGAGGC
    CATCCTGCCCGAGTACGGCACCCTGGGCCTGGAGTGCAGCCCCAGGACTGGCCTGGACTTCAACAGGGTG
    GTGCTGCTGACCATGAAGAAGAAGAGCTGGCTGGTGCACAAGCAGTGGTTCCTGGACCTGCCCCTGCCCT
    GGACCGCCGGCGCCGACACCAGCGAGGTGCACTGGAACCACAAGGAGAGGATGGTGACCTTCAAGAACGC
    CCACGCCAAGAGGCAGGACGTGACCGTGCTGGGCAGCCAGGAGGGCGCCATGCACAGCGCCCTGGCCGGC
    GCCACCGAGATCCAGATGAGCAGCGGCAACCTGCTGTTCACCGGCCACCTGAAGTGCAGGCTGAAGATGG
    ACAAGCTGCAGCTGAAGGGCGTGAGCTACGTGATGTGCACCGGCAGCTTCAAGCTGGAGAAGGAGGTGGC
    CGAGACCCAGCACGGCACCGTGCTGGTGCAGGTGAAGTACGAGGGCACCGACGCCCCCTGCAAGATCCCC
    TTCAGCACCGAGGACGGCCAGGGCAAGGCCCACAACGGCAGGCTGATCACCGTGAACCCCATCGTGATCG
    ACAAGGAGAAGCCCGTGAACATCGAGCTGGAGCCCCCCTTCGGCGAGAGCTACATCGTGGTGGGCGCCGG
    CGAGAAGGCCCTGAAGCTGAGCTGGTTCAAGAAGGGCAGCAGCATCGGCAAGATGTTCGAGGCCACCGCC
    AGGGGCGCCAAGAGGATGGCCATCCTGGGCGAGACCGCCTGGGACTTCGGCAGCGTGGGCGGCCTGCTGA
    CCAGCCTGGGCAAGGCCGTGCACCAGGTGTTCGGCGCCATCTACGGCGCC
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Dengue virus DNA vaccine sABC encoding prM and E , Dengue virus DNA vaccine sB encoding E
2. E protein
3. E protein from Dengue 1
  • Gene Name : E protein from Dengue 1
  • Sequence Strain (Species/Organism) : Dengue virus 1
  • NCBI Protein GI : 148372385
  • Other Database IDs : CDD:201480
    CDD:190444
    CDD:211963
  • Taxonomy ID : 11053
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope protein
  • Protein Length : 495
  • Protein Note : Flavivirus glycoprotein, central and dimerisation domains; pfam00869
  • Protein Sequence : Show Sequence
    >gi|148372385|gb|ABQ63116.1| envelope protein [Dengue virus 1]
    MRCVGIGSRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPAVLRKLCIEAKISNTTT
    DSRCPTQGEATLVEEQDANFVCRRTFVDRGWGNGCGLFGKGSLITCAKFKCVTKLEGKIVQYENLKYSVI
    VTVHTGDQHQVGNESTEHGTTATITPQAPTTEIQLTDYGALTLDCSPRTGLDFNEMVLLTMKEKSWLVHK
    QWFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQEVVVLGSQEGAMHTALTGATEIQTSGTTTIFA
    GHLKCRLKMDKLTLKGMSYVMCTGSFKLEKEVAETQHGTVLVQIKYEGTDAPCKIPFSTQDEKGVTQNGR
    LITANPIVTDKEKPVNIEAEPPFGESYIVIGAGEKALKLSWFKKGSSIGKMFEATARGARRMAILGDTAW
    DFGSIGGVFTSVGKLVHQIFGTAYGVLFSGVSWTMKIGIGVLLTWLGLNSRSTSLSMTCIAVGLVTLYLG
    VMVQA
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Dengue virus DNA vaccine D1ME encoding prM and E , Dengue Virus DNA Vaccine D1ME-VRP
4. E protein from Dengue 3
  • Gene Name : E protein from Dengue 3
  • Sequence Strain (Species/Organism) : Dengue virus 3
  • NCBI Protein GI : 166092240
  • Other Database IDs : CDD:201480
    CDD:190444
    CDD:211963
  • Taxonomy ID : 11069
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope
  • Protein Length : 493
  • Protein Note : genotype: I
  • Protein Sequence : Show Sequence
    >gi|166092240|gb|ABY82135.1| envelope [Dengue virus 3]
    MRCVGVGNRDFVEGLSGATWVDVVLEHGGCVTTMAKNKPTLDIELQKTEATQLATLRKLCIEGKITNVTT
    DSRCPTQGEAILPEEQDQNYVCKHTYVDRGWGNGCGLFGKGSLVTCAKFQCLESIEGKAVQHENLKYTVI
    ITVHTGDQHQVGNETQGVTAEITPQASTVEAILPEYGTLGLECSPRTGLDFNEMILLTMKNKAWMVHRQW
    FFDLPLPWTSGATTETPTWNKKELLVTFKNAHAKKQEVVVLGSQEGAMHTALTGATEIQTSGGTSIFAGH
    LKCRLKMDKLELKGMSYAMCLNAFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLI
    TANPIVTKKEEPVNIEAEPPFGESNIVIGIGDKALKINWYKKGSSIGKMFEATARGARRMAILGDTAWDF
    GSVGGVLNSLGKMVHQIFGSAYTALFSGVSWIMKIGIGVLLTWIGLNSKNTSMSFSCIVIGIITLYLGAV
    VQA
  • Molecule Role : Protective antigen
5. E protein from Dengue 4
  • Gene Name : E protein from Dengue 4
  • Sequence Strain (Species/Organism) : Dengue virus 4
  • NCBI Protein GI : 369726339
  • Other Database IDs : CDD:201480
    CDD:190444
    CDD:211963
  • Taxonomy ID : 11070
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope protein
  • Protein Length : 495
  • Protein Note : type: Dengue virus; genotype: IIa
  • Protein Sequence : Show Sequence
    >gi|369726339|gb|AEX20298.1| envelope protein [Dengue virus 4]
    MRCVGVGNRDFVEGVSGGAWVDLVLEHGGCVTTMAQGKPTLDFELTKTTAKEVALLRTYCIEASISNITT
    ATRCPTQGEPYLKEEQDQQYICRRDVVDRGWGNGCGLFGKGGVVTCAKFLCSGKITGNLVQIENLEYTVV
    VTVHNGDTHAVGNDTSNHGVTATITPRSPSVEVKLPDYGELTLDCEPRSGIDFNEMILMKMKKKTWLVHK
    QWFLDLPLPWTAGADTSEVHWNYKERMVTFKVPHAKRQDVTVLGSQEGAMHSALAGATEVDSGDGNHMFA
    GHLKCKVRMEKLRIKGMSYTMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKIPIEIRDVNKEKVVGR
    IISSTPFAENTNSVINIELEPPFGDSYIVIGVGDSALTLHWFRKGSSIGKMFESTYRGAKRMAILGETAW
    DFGSVGGLFTSLGKAVHQVFGSVYTTMFGGVSWMIRILIGFLVLWIGTNSRNTSMAMTCIAVGGITLFLG
    FTVQA
  • Molecule Role : Protective antigen
  • Related Vaccine(s): CAdVax-Den12/Den34 , Dengue Virus DNA Vaccine expressing prM/E proteins
6. M protein
  • Gene Name : M protein
  • VO ID : VO_0011316
  • NCBI Protein GI : 73671170
  • Other Database IDs : CDD:110035
  • Taxonomy ID : 11070
  • Gene Strand (Orientation) : ?
  • Protein Name : membrane (M) protein
  • Protein Length : 75
  • Protein Note : Flavivirus envelope glycoprotein M; pfam01004
  • Protein Sequence : Show Sequence
    >gi|73671170|ref|NP_740316.1| membrane (M) protein [Dengue virus 4]
    SVALTPHSGMGLETRAETWMSSEGAWKHAQRVESWILRNPGFALLAGFMAYMIGQTGIQRTVFFVLMMLV
    APSYG
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A recombinant vaccinia virus that expressed the M protein of Dengue 4 virus was constructed. Mice immunized with the recombinant virus were protected against subsequent dengue 4 encephalitis challenge (Bray and Lai, 1991).
  • Related Vaccine(s): Dengue Vaccine using Vaccinia Virus expressing M Protein
7. NS1
  • Gene Name : NS1
  • VO ID : VO_0011312
  • NCBI Protein GI : 288848
  • Other Database IDs : CDD:109983
    InterPro: IPR001157
    UniProtKB/TrEMBL: Q06371
  • Taxonomy ID : 11060
  • Gene Strand (Orientation) : ?
  • Protein Length : 380
  • Protein Note : Flavivirus non-structural Protein NS1; pfam00948
  • Protein Sequence : Show Sequence
    >gi|288848|emb|CAA78918.1| NS1 [Dengue virus type 2]
    MNSRSTSLSVSQVLVGIVTLYLGVMVQADSGCVVSWKNKELKCGSGIFVTDNVHTRTEQYKFQPESPSKL
    ASAIQKAHEEGICGIRSVTRLENLMWKQITSELNHILSENEVKLTIMTGDIKGIMQVGKRSLRPQPTELR
    YSWKTWGKAKMLSTELHNQTFLIDGPETAECPNTNRAWNSLEVEDYGFGVFTTNIWLRLREKQDAFCDSK
    LMSAAIKDNRAVHADMGYWIESALNDTWKIEKASFIEVKSCHWPKSHTLWSNGVLESEMVIPKNFAGPKS
    QHNNRPGYHTQTAGPWHLGKLEMDFDFCEGTTVVVTEDCGNRGPSLRTTTASGKLITEWCCRSCTLPPLR
    YRGEDGCWYGMEIRPLKEKEENLVSSLVTA
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The protective efficacy and immune responses of mice intramuscularly injected with plasmid encoding DEN-2 non-structural protein 1 (NS1) was evaluated. Intravenously challenged by lethal DEN-2, mice vaccinated with NS1-DNA exhibited a delay onset of paralysis, a marked decrease of morbidity, and a significant enhancement of survival (Wu et al., 2003).
  • Related Vaccine(s): Dengue DNA Vaccine encoding NS1 Protein , Dengue Virus DNA Vaccine encoding NS1 , Dengue virus DNA vaccine pcTPANS1 encoding NS1 fused to the tissue plasminogen activator signal sequence
8. PrM
  • Gene Name : PrM
  • VO ID : VO_0011315
  • NCBI Protein GI : 18308086
  • Other Database IDs : CDD:110567
    CDD:110035
  • Taxonomy ID : 11070
  • Gene Strand (Orientation) : ?
  • Protein Name : premembrane
  • Protein Length : 131
  • Protein Note : Flavivirus polyprotein propeptide; pfam01570
  • Protein Sequence : Show Sequence
    >gi|18308086|gb|AAL67829.1|AF459627_1 premembrane [Dengue virus 4]
    FHLSTRDGEPLMIVAKHERGRPLLFKTTEGINKCTLIAMDLGEMCEDTVTYKCPLLVNTEPEDIDCWCNL
    TSTWVMYGTCPQSGERRREKRSVALTPHSGMGLETRAETWMSSEGAWKHAQRVESWILRNP
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A recombinant vaccinia virus that expressed the pre-M protein of Dengue 4 virus was constructed. Mice immunized with the recombinant virus were protected against subsequent dengue 4 encephalitis challenge (Bray and Lai, 1991).
  • Related Vaccine(s): Dengue Vaccine using Vaccinia Virus expressing prM Protein , Dengue Virus DNA Vaccine expressing prM/E proteins
9. prM from Dengue 1
10. prM from Dengue 2
11. prM from Dengue 3
  • Gene Name : prM from Dengue 3
  • Sequence Strain (Species/Organism) : Dengue virus 3
  • NCBI Protein GI : 18308070
  • Other Database IDs : CDD:110567
    CDD:201546
  • Taxonomy ID : 11069
  • Gene Strand (Orientation) : ?
  • Protein Name : premembrane
  • Protein Length : 110
  • Protein Note : Flavivirus polyprotein propeptide; pfam01570
  • Protein Sequence : Show Sequence
    >gi|18308070|gb|AAL67821.1|AF459619_1 premembrane [Dengue virus 3]
    FHLTSRDGEPRMIVGKNERGKSLLFKTASGINMCTLIAMDLGEMCDDTVTYKCPHITEVEPEDIDCWCNL
    TSTWVTYGTCNQAGEHRRDKRSVALAPHVGMGLDTRTQTW
  • Molecule Role : Protective antigen
  • Related Vaccine(s): CAdVax-Den12/Den34
1. Il12a
  • Gene Name : Il12a
  • Sequence Strain (Species/Organism) : Mus musculus
  • NCBI Gene ID : 16159
  • NCBI Protein GI : 226874945
  • Genbank Accession : AC121306
  • Protein Accession : NP_001152896
  • Taxonomy ID : 10090
  • Chromosome No : 3
  • Gene Starting Position : 68690643
  • Gene Ending Position : 68698546
  • Gene Strand (Orientation) : +
  • Protein Name : transcript variant 1
  • Protein pI : 8.33
  • Protein Weight : 25111.9
  • Protein Length : 236
  • Protein Note : Also known as p35; Ll12a; Il-12a; IL-12p35; MGC151228; MGC151232
  • DNA Sequence : Show Sequence
    >gi|372099107:68690643-68698546 Mus musculus strain C57BL/6J chromosome 3, GRCm38 C57BL/6J
    CTGCCACCTACTCCCTTGGATCTGAGCTGGACCCTTGCATCTGGCGTCTACACTGCTGCTGAAATCTTCT
    CACCGTGCACATCCAAGGATATCTCTATGGTAAAAGTCCAGAAAGGCTAAAGATGTTGTCCACAATCTCT
    CGGCAATGACCAGATATATCCCCACCAGTATCACAACTTGCAACGCGCTCCGTTCCCATCTGCCCTCTGC
    CTCCCTACTGTGTTGATTCCCATTTCCAAAACTAGCTCAGAATGCATCCCACTGGCAGCCAGGCAATGCC
    TTCTTGCAGATCTGGAGGCTTCAGGAGCCTTTGCTGCCTCTTAGGCTCCTGCAGAGAGATGGCCTTGCTC
    TCTCTGGGCCCTTTTCCCCCAAGATGCTGTGCAGTCGTCTCACTAAATCAAAACTGCCAGAACTGAGTTT
    TAAGCGATATATAGCCACCACATCTATTTTGTTCCTTTATACTTTCAAAGTAGGACAGATTCGCAAAATA
    CATTGAGTCAGACTCAGTGTCCACGATGGAGAGACGAGTGGGTAGCTTGTGCTTCTTTAGAAGGGGCACT
    GGGCAGCGTGTTAGGGCTAGGGGGTAGTGGGGCAGGACAGACCTGTCCCGGGACAAGAGTGGCTACTCGC
    AGGCCGGTTTTGCTTTCGCTCTGAGTGTGGTGGGCGGTGGGACGGTCCCGAATCTCCTCAAACGGGCACT
    CCGAGAGTTAATTCGAAAGCGCCACCAGCCTTGGGGGCGATCGACGCACTTGTCCTTGAGATGTAGAGAC
    AGAGAGAGAAAGCAAGAGACACAGTCCTGGGAAAGTCCTGCCGGCTATCCAGACAATTATAAAAATGTGT
    CTCCCAAGGTCAGCGTTCCAACAGCCTCACCCTCGGCATCCAGCAGCTCCTCTCAGTGCCGGTCCAGCAT
    GTGTCAATCACGCTGTAAGTACCTGAGGGCCGGGACCAGGGTGACTTGATGAGAGGAGAAGGCTTGAGAA
    AGAACAGACAGAAGCCCTGGACCCATTAAGGGAGACTAAAGGGCTGCCAGCAACTGCAGGCCAAGGGAAG
    GAAGAGGGGAAAGATGGTCGTGCTAGATTGCGCTGCACCGAGCATGGTCTCATTATAGAACAACCCTGGG
    GGCTACGGCTATGCCCGTTTCACAGAAGAGAACTAAAGCCCAGCCTTGAAACCAATGTAAGGAAAATGCA
    GGTCTCAGGCAGTCCCCAAACAAGATCTGGGAGGTCTTGCTTCATCTGTCAGCCCCGGGGAAGGGCTTAA
    ATTATGTGTGGAGGGAGGTCAGTACCCAGAATGGATGGAAAAAATTGCCAGAATGGCTGAAGAAAGAGGC
    AGGTCAAAACCAAGTTGACAAGCTCCACCTGCCCTTTGTTTCCCTTCCAGACCTCCTCTTTTTGGCCACC
    CTTGCCCTCCTAAACCACCTCAGTTTGGCCAGGGTCATTCCAGTCTCTGGACCTGCCAGGTGTCTTAGCC
    AGTCCCGAAACCTGCTGAAGACCACAGATGACATGGTGAAGACGGTGAGTTTCTCCTGTCCTTCTGGCTT
    CAAAGTTCCGCTGTTGACATGACTTCTAACCTATCTGGTATCTGCTGGGAAGTTTATGGTATCTGGCAGG
    AACCGTAGAGGGTTTCAAGACTTCTAAATATAATCTAAAGGAAACTGTGTCTCTAGAGAAAGGAAGAATG
    GTAATAAATTGTAACGGCATCGGTTTAGGCTGTGTCTACACAGAGGAAAGTGGGGACTTGCAATGTCCCT
    CCCAGCCTGCCTGCCTGTGTGACACAGTGTCAGGTGCTCCCTGCTTCTGCTTCAGGGCAGGTGGAACAGG
    GAGACAGTCTCTAGGTACACTCTCTGTGCTTCACAAGCCATAGAGATGAATTAGATTGTCTCTCCCCCTG
    CTCACCAGTGTCCAGCACTGTGATGCAGTCCCTTGTCGGATGGACACATGTCAGGGAGGACTCAGACATC
    AGATAGCAAGCAGGTCCAGCCTCCAGTTTTCTGGGGCAAGTGTGATCCAGTTTTAGTCACGGCTCCACTC
    ATTTTTCTCAGGTTTCATGTTTGAATGCAAAATAGCCTTTTCCGTTGTAAAATTGCCACGGTTTCCTCTC
    GCTTTGGGGACAAAGCTACAGCAAAATGCTAATGTGTTTGAGATATCCTGCAGCTGCTAGGGCTGGAGAT
    CCAGTAGAATTCTGGCTTAATTATGAATGGGTCTCCCGGGTTCTATCCCCCAACAGAGCGTGCGTTCATA
    AGCACCTGGGAACAGAGGAGGGAAGGAGGGAAACTCTGTCTTCCTGTTTTGTTTTTAAATCTTTCTTGAG
    GATCTTCTAGCTTGTTGTCTTATGGCTATCCCAACATAAGCTCCGCTCCACAAGCCCTTCTTGGTGAATT
    TTCTTTCTTTCCTTCCCGTCTTGCATAACGTGCTGCTGGCTGTTCCTCCAAGCTCAGTCTTAATTGAGTG
    GGGTTCCCAGGAGGGAGAGATGGCTCTGTGGTTAAGAGAGCTGGCTGCTCTTCCAGAGGTCCAGAGTTTC
    CACACCCTCATGGTGGCTCACAATCATGGTAACTCTGATCATAGGGAACCTGTCGTTTTCTCTGTGCCTC
    TGTGGGCACTGAGCACATGCCACACAGACATCCATGCAGGCAGAACACTCTTGGCCATGAAACCTTAAAA
    TGAAGGAGAAACCTTACGAGAGGTTCCCTAAGGAATCCCTGCAGAAGGGAGAGATTGTTTTCCTAAGATG
    AGGTTTGGTGTGGAGGGGATGAGGTATTCAAAGTTAACTAGCCGCTCCTCACTCCTCTGCTGCCAAATAC
    CAGCACTGGGCTTCGAGACACAATAGAATTCGACCTTGTTTTCGTTTGGGTCACTATTGCTCTCTAGTTG
    AACACGGAATCCACGGGGGCACATTGCTGTCTGTCCTTTGTCACACCCCAGGACCACAGCTGCATGGAAA
    AGTCATCGCAGGCTTCAGTCAGAGAGCTGTTGACTTCCTAATATGTTGTGTAATTCTGTTCAGTGGTGCT
    TTCCAGCACACCAGGGAATAAGAGACAGTCCCCGCGTATGTAAATTAAAGCTCAACTAGTATTTAGGGCT
    TGCAAGTTTGTTACAGCCATCAAGCTGTGACTTTAACAGTTTCCTCTTTAGAAGTTAAACTTGAAAAAAA
    ATAGAGGGAGAGAGAGATTCACAGGGCACAGCTGCTTGGAAAAAGGAAAAGCCACAGGACTCACCAGAAG
    CAAGCAGCACAGTGTGGCACTGATGCTGATGAGTACAGCCTGCTGCACCCCAGTGTTCACATGGTGAAAA
    AAATACCCTGCTGGCGGACAGCCTAGGCAAAGGGGGAGGAGAGTAGGGAGAGCGTGCGGGAGGTTGGGTT
    TCTTAGCTTATGAAGAGCCTGAGTTTCCTACAGGCCAAAGAGATGACGGTTCAGAGTGGCCAGCCTAGGC
    TCTGCTGATCCACTGCGATGCAGGTCTCAGAGGGAACCAGCTGTCTTGCTGAGAGATTCACCTCAGCTTC
    TCCTTATGTTTTTCCCAGGCCAGAGAAAAACTGAAACATTATTCCTGCACTGCTGAAGACATCGATCATG
    AAGACATCACACGGGACCAAACCAGCACATTGAAGACCTGTTTACCACTGGAACTACACAAGGTATGGAG
    GACCCCCACCCAAAAAACAACAACAACAACAACAAAAAACACAATTAAGAGCCGTGCAGCCAACCTCAGC
    TGTCTCCAGATACTTACTTGTAGCTATCAAACGTGAGAGTTTTGAAGAAAAAAAAAAAAGTCAACAACCA
    TACAAATACTTCTACAAGCTGAAGGATATACTCGGTAACTAGGAGGTGGCTATGGTGGTATAGACCTTTA
    ATTCCAGCACTTGATGGATAGAGGAAGGCCGGCTCCTGTTAAGTTAGAGGCCAGTCAGGGATACACAGCA
    AGATTTCATCTTTAAAAAGAAAGGGGGTGGTGTGGCGGGTGAAGCTTACTTATTGAAGTGCTCATGTCAC
    AAGCCTGGGGACCTAAGTTCCCATCCCCAGCACCCATGTAGGAGCTGGGTGTGATGGTTTCACATGCAGA
    GACAGGAGGATACCTGGGCCAGCTAGTCTAGCCGAATCCATGAGCTGCAGGCCCAGTGAGAGAACCTGTA
    TCAGAAAACAAGAAAGTCAGGAGAGCGGCTGAGAAAGACCCCAAAGATCATCCTCCGATTTCCACGAGTA
    CATGCACCTGCACACACGTGCACACAGGAATCCTATACATAGCCACCCAAAAGCAGTTATGATGGTGAAG
    TTTCTTTTACTGGAATGAAAAGTTAGTTTGAGAAAAAAATATCAGAGAGATTTATATTAAGAGTGAATGG
    GTGGGGGGTATGCATGCCTTTAATCTCAGCACTTGATAGGCAGAGGCAGATGGATCTCTGTGAGTTCAAG
    GCCGGCCTGGTCTACAGAGTAAGTTCCAGGACAGCCAGTGCTACAATAGAAACAGGTGATGGTGATGATG
    GTGATGATGGCGGTGATGATGATGATGATGACGAAGACAAACTCCTCGGTTTATGATTTTCTTCTAGAAC
    GAGAGTTGCCTGGCTACTAGAGAGACTTCTTCCACAACAGTAAGTAAGCACTCTAAGGGTTCCTTCCCCA
    TGACGGATTCATAACACTGATGCCTGGTCATTCTTTCTCTAGAGAGGGAGCTGCCTGCCCCCACAGAAGA
    CGTCTTTGATGATGGTAAGCCACATCACTTTTCTGAAATGCAGCAGGGTCCTGTAGTTCCAGCCCATCTC
    AATGATTCCTTGCCCATTGTGTCCTGCGCTCTAGACCCTGTGCCTTGGTAGCATCTATGAGGACTTGAAG
    ATGTACCAGACAGAGTTCCAGGCCATCAACGCAGCACTTCAGAATCACAACCATCAGCAGATCATTCTAG
    ACAAGGGCATGCTGGTGGCCATCGATGAGCTGATGCAGGTAAGCCTTCCTCCTATCAGCCAGCGCTCCTT
    TTCCATGGTGAAGAGAGGTCCTTTATTAGATATGATAAAATCAGCACAGCTTGGGTTGGGAGAGACCTGA
    ACACCCCCACCCCACCCCACACCCTCATCCCCCAACCATGAAAGGCCTTGCAAGGTTACATTTGCTTAGA
    GAGCCTTGAGGGGGCCTCTACAATAAGGGCAAATGCAAGCAGCCTTCTACTTGTTGACTCATGATACAAA
    TCAGGCACTTTTCAAATGCTTCTTCTCATACCATCCCCACAACAAGCAAATAAGGTCTCTACAGAGGAGG
    AAACTGAAGCTTAAGAGGATGAACGAGGGTTCCCTACAAAAGGGTTTTTTGTTGTTTGGTTTGGTTTGGT
    TTGGTTTGGTTTGGTTTGGTTTTTCCGAGACAGGGTTTCTCTGTATAGCCCTGGCTGTCCTGGAACTCAC
    TTTGTAGATCAGGCTGGCCTCGAACTCAGAACTCCACCTGCCTCTGCCTCCCAAGTGCTGGGATTAAAGG
    TGTGCGCCACCATTGCCCAGCTTATTGTTGTTTTAAATACATTCTTTTCTTAAAGGTTCAAGATTAGGAC
    TGGAGAGACAGTCCGATGATTAAGAGGACTTGAGTTTGGCCTGGGGCTCCTATGTAACAAACAGGGTGTG
    GTCCTGAACTGCTCTCTAACTCCAGAGAGTGGAGACAGGAGGCCTATGGAGGCTTTCTTGCTGCAAGTTT
    AGCCATGAAATCTCCAGGTTCAGGGAGAAAGCATGCCTCAAAGAAATAAGATGGAGAGTCACGTGATCTC
    TTCTCTGGCTTCTGCATGGTGTAGGCACAGATATGCACATGTTTGAGTGCATACAATACAGGCAAACATA
    CACGTGTCCTTTTTAAAATGTATAGGATGGACATTCTAGGGGCTGCACACATATTCAAATATTACTAGGG
    GAAGCACTTGGGGCTGGTGTCCAAGTATAATCTATTTTGAACCAAAATGTGACCAAAATGAAAAGTGGTC
    TTACATCTAGGTAATTACAGTGTTAGGTATCCGTGGGAACTTTGCTGTACCACCAGTAACACAAAGCACA
    GGAGTGTGCACACCAGAGACAAGCACCTTGGCAACCAAGGCGTGGGATGAACATATGTTCAGAAGTCACT
    GCCTGGAAAGCAATTGTTTTTCATTTCATACATACTGTCTTGCACAGGGTTTCTATGTCTTAGATAAAAT
    ATCATGACGGAAAGCAAGTTGGGGAGGAAAGGGTTTATTTCATCTTGTAGAGTGTAGTGAGTCTATTACC
    CAGGGAAGTGGAGGCAGAAGCTGATGCTGGAGAGGACTCCTGGTGACTGGAGTGCTCCACATGACTTGCT
    CAGTGTGCTTTGTATAGCACCCAGGACCACCAGGCTAGGGTGAGCTGGTGCCTCCCACATCAACTGTCAA
    TCAAGAAAATCACCAGAGGCTTGCCCACTGGCCAATCTGGCTGGAGGTGTTTTTCTCAATGACCACAGGC
    TTGTGTAGAGTTAACATAAAAGCACCCAGGACATTACATATTGCCAGATGACTCCTTTGAAAGACAGTGA
    AGTTTATGCAGGTCAAACAACCTATCATGTAGAGATTTGTAATGGATATTGCATGAACAAGGCCAGAAGT
    CAGGTGATTTGGATAGTAGGAAGAGGTCTACCAGGGACCAGCCAACTATGCTGACAGGGTTAACTCTTGT
    CAGCCTGTTTGTAAAATAAGATGACTTTAAATAGCCTATGTCTCTCTTGAGATTTTTGTGAGGAGCAAGC
    AAAAATCTTAAACATCACAGAAACCTAAGTTCTTATTCTATGTTATGAAATCAAAGGATCGAGTGGGGAA
    ACACGGTACTGGCTTGTTTATCTACCACAAATAGCGTTTCTATCAGAGATAGGTCTGTTGTTGATAATAA
    GCTCTAATCCATAGATCCTACTTACCCTCCAACTCCCTCCTCTAAAAGAACAGGACTTCTTAACATAATT
    TATAAAAATTAATTAGCTATTGCTGCAGGTGCTACCTCATAGACTCACACCTTCTGAGAGATCAGCTCTA
    ATGACAATTTCTTTCTGGAAAATTTAGGGGTCTTGTCAGAGATCATTAAAAACATAGGTATATGCTCACA
    AAAGAGTATTTCTTCCCTCTTTTCCTGCAGGAACACAGCAGGAGTAGATGTGAAATGGGTCTAGGAGTGT
    GATGAGGGGCTAGGTTGCAGGCCCTGGACTTTGCATTGACTGTCTCCCATTTTGCAGACAAACATTCTAA
    TTTTTAAATTGTGCATATGCTATGCTTGGTGTTTCTTTCTAGTCTCTGAATCATAATGGCGAGACTCTGC
    GCCAGAAACCTCCTGTGGGAGAAGCAGACCCTTACAGAGTGAAAATGAAGCTCTGCATCCTGCTTCACGC
    CTTCAGCACCCGCGTCGTGACCATCAACAGGGTGATGGGCTATCTGAGCTCCGCCTGAAAGGCTCAAGGC
    CCTCTGCCACAGCGCCCTCCTCACACAGATAGGAAACAAAGAAAGATTCATAAGAGTCAGGTGGTCTTGG
    CCTGGTGGGCCTTAAGCTCCTTCAGGAATCTGTTCTCCCATCACATCTCATCTCCCCAAAGGTGGCACAG
    CTACCTCAGCATGGTCCCCTCCATCGCTTCTCTCATATTCACTATACAAGTTGTTTGTAAGTTTTCATCA
    AAATATTGTTAAGGGGCGAAGACGTCCTCCCCTCAATGTGTTAGCAGAAGAGCAAGAACTGATAAGCTAT
    TGTTTTTGTGCCAAAGTGTTTATGAAAACACTCAGTCACCCCTTATTTAAAAATATTTATTGCTATATTT
    TATACTCATGAAAGTACATGAGCCTATTTATATTTATTTATTTTCTATTTATTATAATATTTCTTATCAG
    ATGAATTTGAAACATTTTGAAACATACCTTATTTTGTGGTTCTAATAAAGTAATGTTATCACTT
  • Protein Sequence : Show Sequence
    >gi|226874945|ref|NP_001152896.1| interleukin-12 subunit alpha isoform 1 [Mus musculus]
    MVSVPTASPSASSSSSQCRSSMCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQSRNLLKTTDDMVK
    TAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLC
    LGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKM
    KLCILLHAFSTRVVTINRVMGYLSSA
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): Dengue DNA Vaccine encoding NS1 Protein
IV. Vaccine Information
1. CAdVax-Den12/Den34
a. Vaccine Ontology ID:
VO_0004643
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
using a complex adenovirus vector, by incorporating the genes expressing premembrane (prM) and envelope (E) proteins of dengue virus types 1 and 2 (dengue-1 and -2, respectively) (CAdVax-Den12) or dengue-3 and -4 (CAdVax-Den34) (Raviprakash et al., 2008).
f. Immunization Route
Intramuscular injection (i.m.)
g. Macaque Response
  • Vaccination Protocol: Rhesus macaques were vaccinated by intramuscular inoculation of a tetravalent dengue vaccine formulated by combining the two bivalent vaccine constructs (Raviprakash et al., 2008).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: The ability of the vaccine to induce rapid, as well as sustained, protective immune responses was examined with two separate live-virus challenges administered at 4 and 24 weeks after the final vaccination (Raviprakash et al., 2008).
  • Efficacy: For both of these virus challenge studies, significant protection from viremia was demonstrated for all four dengue virus serotypes in vaccinated animals. Viremia from dengue-1 and dengue-3 challenges was completely blocked, whereas viremia from dengue-2 and dengue-4 was significantly reduced, as well as delayed, compared to that of control-vaccinated animals (Raviprakash et al., 2008).
2. Dengue DNA Vaccine encoding NS1 Protein
a. Vaccine Ontology ID:
VO_0011454
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of NS1
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
pcDNA3 (Wu et al., 2003)
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
  • Host Strain: C57/BL6, Balb/c, and C3H
  • Vaccination Protocol: Groups of 3–4 weeks old female C3H mice were initially immunized with 80 μg of recombinant DNA pD2NS1, or pcDNA3 as a control. Recombinant pD2NS1 in PBS, control pcDNA3 in PBS, or PBS buffer alone was intramuscularly (i.m.) injected into the mouse thighs; the mice were subsequently boosted twice using the same method at 1 week interval (Wu et al., 2003).
  • Challenge Protocol: One week after the final boost, mice were i.v. challenged with 5×106 plaque-forming units of PL046 in 100 μl PBS. The mice after virus challenge were monitored daily for morbidity and mortality for weeks (Wu et al., 2003).
  • Efficacy: Intravenously challenged by lethal DEN-2, mice vaccinated with NS1-DNA exhibited a delay onset of paralysis, a marked decrease of morbidity, and a significant enhancement of survival (Wu et al., 2003).
3. Dengue Subunit E Protein Vaccine
a. Vaccine Ontology ID:
VO_0011457
b. Type:
Subunit vaccine
c. Status:
Research
d. Gene Engineering of E protein
  • Type: Recombinant protein preparation
  • Description: Baculovirus was used to generate the recombinant protein (Delenda et al., 1994).
  • Detailed Gene Information: Click here.
e. Adjuvant: complete Freunds adjuvant
f. Adjuvant: incomplete Freunds adjuvant
g. Vector:
Baculovirus (Delenda et al., 1994)
h. Immunization Route
Intraperitoneal injection (i.p.)
i. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Three-week-old female BALB/c mice were immunized by intraperitoneal injection on days 1,7, 21 and 56 with 200 gl of baculovirus infected Sf9 cell lysates (CL) or concentrated supernatant fluids (SF) supplemented with complete Freund adjuvant for the first and with incomplete Freund adjuvant for the three other injections.
  • Challenge Protocol: Mice were challenged withDEN-2 virus (Delenda et al., 1994).
  • Efficacy: Sixty eight percent (P < 0.001) of mice vaccinated with 5 gg of extracellular D2EA102 protein were protected against lethal challenge (Delenda et al., 1994).
4. Dengue Vaccine using Vaccinia Virus expressing M Protein
a. Vaccine Ontology ID:
VO_0011455
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Gene Engineering of M protein
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
Vaccinia virus (Bray and Lai, 1991).
f. Immunization Route
Intraperitoneal injection (i.p.)
g. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: BALB/c mice were immunized by i .p .inoculation of 107 p .f .u . of recombinant vaccinia virus expressing M protein (Bray and Lai, 1991).
  • Challenge Protocol: The mice were challenged at age 6 weeks by intracardiac (i.c.) challenge of 100 LD50 of D4 virus, then observed 21 days for signs of encephalitis or death (Bray and Lai, 1991).
  • Efficacy: Mice immunized with the recombinant virus were protected against subsequent dengue 4 encephalitis challenge (Bray and Lai, 1991).
5. Dengue Vaccine using Vaccinia Virus expressing prM Protein
a. Vaccine Ontology ID:
VO_0011452
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Gene Engineering of PrM
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
Vaccinia virus (Bray and Lai, 1991).
f. Immunization Route
Intraperitoneal injection (i.p.)
g. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: BALB/c mice were immunized by i .p .inoculation of 107 p .f .u . of recombinant vaccinia virus (Bray and Lai, 1991).
  • Challenge Protocol: The mice were challenged at age 6 weeks by i .c challenge of 100 LD50 of D4 virus, then observed 21 days for signs of encephalitis or death (Bray and Lai, 1991).
  • Efficacy: Mice immunized with the recombinant virus were protected against subsequent dengue 4 encephalitis challenge (Bray and Lai, 1991).
6. Dengue virus DNA vaccine 1040D2MEL encoding dengue-2 prM-E-LAMP chimeric protein
a. Vaccine Ontology ID:
VO_0004473
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Antigen
E, prM, and LAMP from dengue virus 2 New Guinea C (Raviprakash et al., 2001)
f. Gene Engineering of prM from Dengue 2
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Gene Engineering of E protein
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
h. Vector:
pVR1040(Vical Inc.) (Raviprakash et al., 2001)
i. Immunization Route
Intramuscular injection (i.m.)
j. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: When injected into mice, D2MEL elicited an enhanced antibody response compared to D2ME, which was further augmented by coimmunization with a plasmid expressing mouse granulocyte-monocyte colony stimulating factor (GM-CSF). Neutralizing antibodies are thought to be of paramount importance for protection against dengue disease (Raviprakash et al., 2001).
7. Dengue virus DNA vaccine D1ME encoding prM and E
a. Vaccine Ontology ID:
VO_0004470
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Monkey
e. Gene Engineering of E protein from Dengue 1
  • Type: DNA vaccine construction
  • Description: Vector pVR1012 expressed the dengue-1 pre-membrane (prM) and full-length envelope (E) genes (Raviprakash et al., 2000).
  • Detailed Gene Information: Click here.
f. Gene Engineering of prM from Dengue 1
  • Type: DNA vaccine construction
  • Description: Vector pVR1012 (Vical Inc.) expressed the dengue-1 pre-membrane (prM) and full-length envelope (E) genes (Raviprakash et al., 2000).
  • Detailed Gene Information: Click here.
g. Vector:
pVR1012 (Vical Inc.) (Raviprakash et al., 2000)
h. Immunization Route
Intramuscular injection (i.m.)
i. Monkey Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Four of the eight i.m.-inoculated monkeys were protected completely from developing viraemia when challenged 4 months after the last dose with homologous dengue virus. The other four monkeys had reduced viraemia compared with the control immunized monkeys. The i.d. -inoculated monkeys showed no reduction in viraemia when challenged with the virus (Raviprakash et al., 2000).
8. Dengue Virus DNA Vaccine D1ME-VRP
a. Vaccine Ontology ID:
VO_0004548
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of prM from Dengue 1
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Gene Engineering of E protein from Dengue 1
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
D1ME-DNA (Chen et al., 2007)
g. Immunization Route
Intramuscular injection (i.m.)
h. Baboon Response
  • Vaccination Protocol: Monkeys were divided into groups DDD, VVV, DDV, and control and immunized with D1ME-DNA or D1ME-VRP as shown in the study design. D1ME-DNA was administered intramuscularly, with 0.5 ml given in each of the two upper arms. D1ME-VRP was delivered intramuscularly, as well (Chen et al., 2007).
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: After the third dose of vaccine, all animals in the DDD group, VVV group, and DDV group had developed neutralizing antibodies. The dengue virus 1-specific IgG response to all vaccination regimens was predominantly of the IgG1 type, with smaller amounts of IgG2 and no measurable amounts of IgG4 (Chen et al., 2007).
  • Challenge Protocol: Twenty weeks after the final immunization, animals were challenged by subcutaneous injection of 105 PFU of live dengue virus 1 (Western Pacific 74 strain) in a 0.5-ml volume (Chen et al., 2007).
  • Efficacy: All vaccination regimens showed significant protection from viremia compared to that of the unvaccinated control group (Chen et al., 2007).
9. Dengue Virus DNA Vaccine encoding NS1
a. Vaccine Ontology ID:
VO_0004549
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
NS1 from dengue virus 2 strain NGC (Costa et al., 2006)
e. Gene Engineering of NS1
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
pcTPANS1 (Costa et al., 2006)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccination Protocol: Male Balb/c mice, 4–6 weeks old, were intramuscularly injected in each hind limb tibialis anterior muscle with 50 μg of the pcTPANS1 or pcDNA3 plasmids dissolved in 50 μl of PBS (100 μg/dose/mice). Mice were inoculated with two DNA doses, given two weeks apart, and bled before immunization and 4 weeks after the first DNA dose (Costa et al., 2006).
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: All Balb/c mice intramuscularly inoculated with the pcTPANS1 presented high levels of NS1-specifc antibodies (Costa et al., 2006).
  • Challenge Protocol: Two weeks after the second DNA dose, each immunized mouse was challenged with intracerebral inoculation with 30 μL of 4.32 log10 PFU of DENV2 (Costa et al., 2006).
  • Efficacy: Vaccinated animals were challenged with intracerebral DENV-2 virus inoculations and a 100% survival was observed (Costa et al., 2006).
10. Dengue Virus DNA Vaccine expressing prM/E proteins
a. Vaccine Ontology ID:
VO_0004547
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
prM and E proteins from dengue virus 4 strain H241 (Lima et al., 2011)
e. Gene Engineering of PrM
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Gene Engineering of E protein from Dengue 4
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Vector:
DENV-4-DNAv (Lima et al., 2011)
h. Immunization Route
Intramuscular injection (i.m.)
i. Mouse Response
  • Vaccination Protocol: Ten 5-week-old female BALB/c mice per immunization group were inoculated three times into the quadriceps muscle with 100 μg of DENV-4-DNAv or pCI (empty vector), DENV-4 heat inactivated (1 × 105 PFU), or PBS. The mice were primed on day 0 and boosted 15 and 30 days after the initial inoculation (Lima et al., 2011).
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: The animals immunized with DENV-4-DNAv produced rising levels, after each vaccine inoculation, of specific neutralizing antibodies against dengue-4 virus (Lima et al., 2011).
  • Challenge Protocol: Fifteen days after the third inoculation, the mice were challenged intracerebrally with a dose of 100LD50, prepared from a DENV-4-infected suckling mouse brain. Mouse mortality was monitored daily for 21 days (Lima et al., 2011).
  • Efficacy: Immunization with DENV-4-DNAv induced significant protection against DENV-4 challenge, where 80% of the challenged mice survived (Lima et al., 2011).
11. Dengue virus DNA vaccine p1012D2ME encoding prM and E from DEN 2 New Guinea C strain
a. Vaccine Ontology ID:
VO_0004474
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of E protein
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Gene Engineering of prM from Dengue 2
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Vector:
pVR1012 (Vical Inc, San Diego, CA) (Porter et al., 1998)
h. Immunization Route
Intramuscular injection (i.m.)
i. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: In a lethal mouse intracerebral challenge model, the vaccine provided a significant level of protection. Sixty percent of the mice immunized with the DEN DNA vaccine plus pUC 19 survived the challenge compared to only 10% in the control group that received vector plus pUC (Porter et al., 1998).
12. Dengue virus DNA vaccine pcTPANS1 encoding NS1 fused to the tissue plasminogen activator signal sequence
a. Vaccine Ontology ID:
VO_0004472
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of NS1
  • Type: DNA vaccine construction
  • Description: Vector pcDNA3 expressed the secretory signal sequence derived from human tissue plasminogen activator (t-PA) fused to the full length of the DENV-2 NS1 gene (Costa et al., 2006).
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3 (Costa et al., 2006)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Vaccinated animals were challenged against DENV-2 in two murine models, based on intracerebral (i.c.) and intraperitoneal (i.p.) virus inoculations, and in both cases, pcTPANS1-immunized mice were protected (Costa et al., 2006).
13. Dengue virus DNA vaccine pE1D2 encoding E from Dengue Virus 2 strain New Guinea C
a. Vaccine Ontology ID:
VO_0004471
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of E protein
  • Type: DNA vaccine construction
  • Description: Vector pcTPA plasmid , a modified pcDNA3 vector (Invitrogen) expressed amino acids 1–398 of the E protein (Azevedo et al., 2011).
  • Detailed Gene Information: Click here.
f. Vector:
pcTPA plasmid , a modified pcDNA3 vector (Invitrogen) (Azevedo et al., 2011)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: All pE1D2-vaccinated mice survived challenge, while 45% of animals immunized with the pE2D2 died after infection. Furthermore, only 10% of pE1D2-immunized mice presented some clinical signs of infection after challenge, whereas most of animals inoculated with the pE2D2 showed effects of the disease with high morbidity degrees (Azevedo et al., 2011).
14. Dengue virus DNA vaccine sA encoding prM and E from Dengue Virus 4
a. Vaccine Ontology ID:
VO_0004466
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Macaque
e. Gene Engineering of E protein
  • Type: DNA vaccine construction
  • Description: Vector pMV10.1 expressed prM and E genes in which the N-terminal 90% of E gene was shuffled (Raviprakash et al., 2006).
  • Detailed Gene Information: Click here.
f. Gene Engineering of prM from Dengue 2
  • Type: DNA vaccine construction
  • Description: Vector pMV10.1 expressed prM and E genes in which the N-terminal 90% of E gene was shuffled (Raviprakash et al., 2006).
  • Detailed Gene Information: Click here.
g. Vector:
pMV10.1 (Raviprakash et al., 2006)
h. Immunization Route
Intramuscular injection (i.m.)
i. Macaque Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Five of six animals vaccinated developed antibodies that neutralized all 4 dengue serotypes in vitro (Raviprakash et al., 2006).
  • Efficacy: When challenged with live dengue-1 or dengue-2 virus, partial protection against dengue-1 was observed (Raviprakash et al., 2006).
15. Dengue virus DNA vaccine sABC encoding prM and E
a. Vaccine Ontology ID:
VO_0004469
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Macaque
e. Gene Engineering of E protein
  • Type: DNA vaccine construction
  • Description: Vector pMV10.1 expressed premembrane and envelope genes of each of four serotypes of dengue viruses (Raviprakash et al., 2006).
  • Detailed Gene Information: Click here.
f. Gene Engineering of prM from Dengue 2
  • Type: DNA vaccine construction
  • Description: Vector pMV10.1 expressed premembrane and envelope genes of each of four serotypes of dengue viruses (Raviprakash et al., 2006).
  • Detailed Gene Information: Click here.
g. Gene Engineering of 18H6 synthetic E protein
  • Type: DNA vaccine construction
  • Description: This combination vaccine encoded all the proteins from all 3 vaccines (Raviprakash et al., 2006).
  • Detailed Gene Information: Click here.
h. Vector:
pMV10.1 (Raviprakash et al., 2006)
i. Immunization Route
Intramuscular injection (i.m.)
j. Macaque Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: When challenged with live dengue-1 or dengue-2 virus, partial protection against dengue-1 was observed. The best protection against dengue-1 viremia was demonstrated by the mixture of shuffled vaccines (sABC) out of all the vaccines tested (Raviprakash et al., 2006).
16. Dengue virus DNA vaccine sB encoding E
a. Vaccine Ontology ID:
VO_0004467
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Macaque
e. Gene Engineering of 18H6 synthetic E protein
f. Vector:
pMV10.1 (Raviprakash et al., 2006)
g. Immunization Route
Intramuscular injection (i.m.)
h. Macaque Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: When challenged with live dengue-1 or dengue-2 virus, partial protection against dengue-1 was observed (Raviprakash et al., 2006).
17. Dengue virus DNA vaccine sC encoding prM and E
a. Vaccine Ontology ID:
VO_0004468
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Macaque
e. Gene Engineering of E protein
  • Type: DNA vaccine construction
  • Description: Vector pMV10.1 expressed prM and E genes in which the N-terminal 90% of E gene was shuffled.a shuffled truncated E protein (Raviprakash et al., 2006).
  • Detailed Gene Information: Click here.
f. Gene Engineering of prM from Dengue 2
  • Type: DNA vaccine construction
  • Description: Vector pMV10.1 expressed prM and E genes in which the N-terminal 90% of E gene was shuffled.a shuffled truncated E protein (Raviprakash et al., 2006).
  • Detailed Gene Information: Click here.
g. Vector:
pMV10.1 (Raviprakash et al., 2006)
h. Immunization Route
Intramuscular injection (i.m.)
i. Macaque Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Four of six animals vaccinated developed antibodies that neutralized all 4 dengue serotypes in vitro (Raviprakash et al., 2006).
  • Efficacy: When challenged with live dengue-1 or dengue-2 virus, partial protection against dengue-1 was observed (Raviprakash et al., 2006).
V. References
1. Azevedo et al., 2011: Azevedo AS, Yamamura AM, Freire MS, Trindade GF, Bonaldo M, Galler R, Alves AM. DNA vaccines against dengue virus type 2 based on truncate envelope protein or its domain III. PloS one. 2011; 6(7); e20528. [PubMed: 21779317].
2. Bray and Lai, 1991: Bray M, Lai CJ. Dengue virus premembrane and membrane proteins elicit a protective immune response. Virology. 1991; 185(1); 505-508. [PubMed: 1926792].
3. Chen et al., 2007: Chen L, Ewing D, Subramanian H, Block K, Rayner J, Alterson KD, Sedegah M, Hayes C, Porter K, Raviprakash K. A heterologous DNA prime-Venezuelan equine encephalitis virus replicon particle boost dengue vaccine regimen affords complete protection from virus challenge in cynomolgus macaques. Journal of virology. 2007; 81(21); 11634-11639. [PubMed: 17715224].
4. Costa et al., 2006: Costa SM, Paes MV, Barreto DF, Pinhão AT, Barth OM, Queiroz JL, Armôa GR, Freire MS, Alves AM. Protection against dengue type 2 virus induced in mice immunized with a DNA plasmid encoding the non-structural 1 (NS1) gene fused to the tissue plasminogen activator signal sequence. Vaccine. 2006; 24(2); 195-205. [PubMed: 16122850].
5. Delenda et al., 1994: Delenda C, Frenkiel MP, Deubel V. Protective efficacy in mice of a secreted form of recombinant dengue-2 virus envelope protein produced in baculovirus infected insect cells. Archives of virology. 1994; 139(1-2); 197-207. [PubMed: 7826210].
6. Konishi et al., 2000: Konishi E, Yamaoka M, Kurane I, Mason PW. A DNA vaccine expressing dengue type 2 virus premembrane and envelope genes induces neutralizing antibody and memory B cells in mice. Vaccine. 2000; 18(11-12); 1133-1139. [PubMed: 10590335].
7. Konishi et al., 2003: Konishi E, Terazawa A, Fujii A. Evidence for antigen production in muscles by dengue and Japanese encephalitis DNA vaccines and a relation to their immunogenicity in mice. Vaccine. 2003; 21(25-26); 3713-3720. [PubMed: 12922102].
8. Konishi et al., 2006: Konishi E, Kosugi S, Imoto J. Dengue tetravalent DNA vaccine inducing neutralizing antibody and anamnestic responses to four serotypes in mice. Vaccine. 2006; 24(12); 2200-2207. [PubMed: 16316713].
9. Lima et al., 2011: Lima DM, de Paula SO, França RF, Palma PV, Morais FR, Gomes-Ruiz AC, de Aquino MT, da Fonseca BA. A DNA vaccine candidate encoding the structural prM/E proteins elicits a strong immune response and protects mice against dengue-4 virus infection. Vaccine. 2011; 29(4); 831-838. [PubMed: 21115054].
10. Liu et al., 2006: Liu WT, Lin WT, Tsai CC, Chuang CC, Liao CL, Lin HC, Hung YW, Huang SS, Liang CC, Hsu HL, Wang HJ, Liu YT. Enhanced immune response by amphotericin B following NS1 protein prime-oral recombinant Salmonella vaccine boost vaccination protects mice from dengue virus challenge. Vaccine. 2006; 24(31-32); 5852-5861. [PubMed: 16759760].
11. Martina et al., 2009: Martina BE, Koraka P, Osterhaus AD. Dengue virus pathogenesis: an integrated view. Clinical microbiology reviews. 2009; 22(4); 564-581. [PubMed: 19822889].
12. Porter et al., 1998: Porter KR, Kochel TJ, Wu SJ, Raviprakash K, Phillips I, Hayes CG. Protective efficacy of a dengue 2 DNA vaccine in mice and the effect of CpG immuno-stimulatory motifs on antibody responses. Archives of virology. 1998; 143(5); 997-991003. [PubMed: 9645204].
13. Ramanathan et al., 2009: Ramanathan MP, Kuo YC, Selling BH, Li Q, Sardesai NY, Kim JJ, Weiner DB. Development of a novel DNA SynCon tetravalent dengue vaccine that elicits immune responses against four serotypes. Vaccine. 2009; 27(46); 6444-6453. [PubMed: 19580892].
14. Raviprakash et al., 2000: Raviprakash K, Porter KR, Kochel TJ, Ewing D, Simmons M, Phillips I, Murphy GS, Weiss WR, Hayes CG. Dengue virus type 1 DNA vaccine induces protective immune responses in rhesus macaques. The Journal of general virology. 2000; 81(Pt 7); 1659-1667. [PubMed: 10859370].
15. Raviprakash et al., 2001: Raviprakash K, Marques E, Ewing D, Lu Y, Phillips I, Porter KR, Kochel TJ, August TJ, Hayes CG, Murphy GS. Synergistic neutralizing antibody response to a dengue virus type 2 DNA vaccine by incorporation of lysosome-associated membrane protein sequences and use of plasmid expressing GM-CSF. Virology. 2001; 290(1); 74-82. [PubMed: 11883007].
16. Raviprakash et al., 2006: Raviprakash K, Apt D, Brinkman A, Skinner C, Yang S, Dawes G, Ewing D, Wu SJ, Bass S, Punnonen J, Porter K. A chimeric tetravalent dengue DNA vaccine elicits neutralizing antibody to all four virus serotypes in rhesus macaques. Virology. 2006; 353(1); 166-173. [PubMed: 16814355].
17. Raviprakash et al., 2008: Raviprakash K, Wang D, Ewing D, Holman DH, Block K, Woraratanadharm J, Chen L, Hayes C, Dong JY, Porter K. A tetravalent dengue vaccine based on a complex adenovirus vector provides significant protection in rhesus monkeys against all four serotypes of dengue virus. Journal of virology. 2008; 82(14); 6927-6934. [PubMed: 18480438].
18. Wu et al., 2003: Wu SF, Liao CL, Lin YL, Yeh CT, Chen LK, Huang YF, Chou HY, Huang JL, Shaio MF, Sytwu HK. Evaluation of protective efficacy and immune mechanisms of using a non-structural protein NS1 in DNA vaccine against dengue 2 virus in mice. Vaccine. 2003; 21(25-26); 3919-3929. [PubMed: 12922127].