VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Borrelia burgdorferi

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. DbpA (Protective antigen)
    2. OspA (Protective antigen)
    3. OspB (Protective antigen)
    4. OspC (Protective antigen)
    5. fla (Virmugen)
  3. Vaccine Information
    1. B. burgdorferi DbpA and OspA Protein Vaccine
    2. B. burgdorferi DbpA Protein Vaccine
    3. B. burgdorferi DNA vaccine encoding strain B31 OspA
    4. B. burgdorferi DNA vaccine pCMV-ZS7/TPA encoding OspC from Borrelia burgdorferi sensu lato
    5. B. burgdorferi OspA Protein Vaccine
    6. B. burgdorferi OspB Protein Vaccine
    7. B. burgdorferi OspC Protein Vaccine
    8. Borrelia burgdorferi fla mutant vaccine
    9. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47A5.20)
    10. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 47E5.21)
    11. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 47E5.20)
    12. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.20)
    13. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.29)
    14. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46B9.21)
  4. References
I. General Information
1. NCBI Taxonomy ID:
139
2. Disease:
Lyme Disease
3. Introduction
Borrelia burgdorferi is a species of Gram negative bacteria of the spirochete class of the genus Borrelia. B. burgdorferi is predominant in North America, but also exists in Europe, and is the agent of Lyme disease. It is a zoonotic, vector-borne disease transmitted by ticks and is named after the researcher Willy Burgdorfer who first isolated the bacterium in 1982. B. burgdorferi is one of the few pathogenic bacteria that can survive without iron, having replaced all of its iron-sulfur cluster enzymes with enzymes that use manganese, thus avoiding the problem many pathogenic bacteria face in acquiring iron (Wiki: B. burgdorferi).
4. Microbial Pathogenesis
B. burgdorferi is deposited in skin lesions left by Ixodes ticks, and can then invade the bloodstream leading to dissemination throughout the body and cause problems in joints and nervous tissues (Salyers and Whitt., 2002).
5. Host Ranges and Animal Models
White footed mouse are the reservoir of B. burgdorferi. The bacteria are carried by ticks which vector the bacteria to other hosts such as humans, as well as small mammals such as voles and shrews. Animal models include rabbits, mice and dogs (Salyers and Whitt., 2002).
6. Host Protective Immunity
In most people B. burgdorferi is cleared from the bloodstream via antibodies and phagocytic cells (Salyers and Whitt., 2002).
1. DbpA
  • Gene Name : DbpA
  • Sequence Strain (Species/Organism) : Borrelia burgdorferi 297
  • VO ID : VO_0012387
  • NCBI Gene ID : 8319341
  • NCBI Protein GI : 256041910
  • Locus Tag : Bbu297_A24
  • Genbank Accession : DQ437419
  • Protein Accession : YP_003110629
  • Taxonomy ID : 521009
  • Plasmid No : 297_lp54
  • Gene Starting Position : 13807
  • Gene Ending Position : 14370
  • Gene Strand (Orientation) : -
  • Protein Name : decorin binding protein A
  • Protein pI : 9.68
  • Protein Weight : 19412.03
  • Protein Length : 187
  • Protein Note : identified by match to protein family HMM PF02352
  • DNA Sequence : Show Sequence
    >gi|256041893:13807-14370 Borrelia burgdorferi 297 plasmid 297_lp54, complete sequence
    ATTACGATTTAGCAGTGCTGTCTTCGGTATTTTTTTTCTTTAAGGTGTCTTGGTTTTTCTTGTGAACCCT
    TTGTAATTTTTCTCTCATTTTTTTTGCAATTTCAAGCACTCCTTGAGCTGTAGTTGGAGGATTCTCTTCA
    GCTGCCATTGAGACTGTTTTTGTCATCTCTTGTATTCCCAATTCTTGTAATGGTTTTGAGACTTCAAACA
    TTAAATCATACATTGCTGAGAATTCACCACTACTTCCAGTTTCTTTAAGTTTAGTAGCTTCCTCTTCTAT
    TGCTATTACGAATTTTTCCGCTACTGTAGTAGCTCGCACTTTTGCTTCAAGTATGAATGGATTTTCTGAT
    ACCCCACTACCCGTTTTTTTATCTTTAAAGGCATCAAAATTTACACCCATAGAAGCAGCCTTTTTTTTAA
    TTGCATCTATTTCATCTACAATGGCTTTAGCTGATGATTCTAATTTGATTTTTGTTGCTCCTGTTAGTCC
    ACATGATATAAGTAGGTTAACAAGTATAGTTAGTTTAAGTAAATTGTTAAAAGTTTTATTATTACATTTA
    ATCA
  • Protein Sequence : Show Sequence
    >gi|256041910|ref|YP_003110629.1| decorin binding protein A [Borrelia burgdorferi 297]
    MIKCNNKTFNNLLKLTILVNLLISCGLTGATKIKLESSAKAIVDEIDAIKKKAASMGVNFDAFKDKKTGS
    GVSENPFILEAKVRATTVAEKFVIAIEEEATKLKETGSSGEFSAMYDLMFEVSKPLQELGIQEMTKTVSM
    AAEENPPTTAQGVLEIAKKMREKLQRVHKKNQDTLKKKNTEDSTAKS
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice immunized with recombinant DbpA protein are protected against challenge with Borrelia burgdorferi (Hanson et al., 2000).
  • Related Vaccine(s): B. burgdorferi DbpA and OspA Protein Vaccine , B. burgdorferi DbpA Protein Vaccine
2. fla
  • Gene Name : fla
  • Sequence Strain (Species/Organism) : Borrelia burgdorferi HB19
  • NCBI Protein GI : 435009
  • Other Database IDs : CDD:183758
    CDD:144315
    CDD:144340
    GOA:Q44895
    HSSP: 1ORY
    InterPro: IPR001029
    InterPro: IPR001444
    InterPro: IPR001492
    InterPro: IPR019776
    UniProtKB/TrEMBL: Q44895
  • Taxonomy ID : 139
  • Gene Strand (Orientation) : ?
  • Protein Name : flagellin
  • Protein Length : 336
  • Protein Note : flagellin; Provisional
  • Protein Sequence : Show Sequence
    >gi|435009|emb|CAA53011.1| flagellin [Borrelia burgdorferi]
    MIINHNTSAINASRNNGINAANLSKTQEKLSSGYRINRASDDAAGMGVSGKINAQIRGLSQASRNTSKAI
    NFIQTTEGNLNEVEKVLVRMKELAVQSGNGTYSDADRGSIQIEIEQLTDEINRIADQAQYNQMHMLSNKS
    ASQNVRTAEELGMQPAKINTPASLSGSQASWTLRVHVGAPQDEAIAVNIYAANVANLFSGEGAQTAQAAP
    VQEGVQQEGAQQPAPATAPSQGGVNSPVNVTTTVDANTSLAKIENAIRMISDQRPNLGAFQNRLESIKDS
    TEYAIENLKASYAQIKDATMTDEVVAATTNSILTQSAMAMIAQANQLPQYVLSLLR
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A flagella-less mutant of Borrelia burgdorferi (HB19Fla-) was attenuated in immunodeficient SCID mice. Mice were challenged 28 days later with virulent strain Sh. 2 and were protected from challenge (Sadziene et al., 1996).
  • Related Vaccine(s): Borrelia burgdorferi fla mutant vaccine
3. OspA
  • Gene Name : OspA
  • Sequence Strain (Species/Organism) : Borrelia burgdorferi B31
  • VO ID : VO_0012384
  • NCBI Gene ID : 1194357
  • NCBI Protein GI : 11496927
  • Locus Tag : BBA15
  • Genbank Accession : AE000790
  • Protein Accession : NP_045688
  • 3D structure: PDB ID : 2HKD
  • Taxonomy ID : 224326
  • Plasmid No : lp54
  • Gene Starting Position : 9392
  • Gene Ending Position : 10213
  • Gene Strand (Orientation) : ?
  • Protein Name : outer surface protein A (ospA)
  • Protein pI : 9.36
  • Protein Weight : 26986.42
  • Protein Length : 273
  • Protein Note : similar to SP:P14013 GB:L23137 GB:L23138 GB:L23139 GB:L23140 percent identity: 98.90; identified by sequence similarity; putative
  • DNA Sequence : Show Sequence
    >gi|11496892:9392-10213 Borrelia burgdorferi B31 plasmid lp54, complete sequence
    TATGAAAAAATATTTATTGGGAATAGGTCTAATATTAGCCTTAATAGCATGTAAGCAAAATGTTAGCAGC
    CTTGACGAGAAAAACAGCGTTTCAGTAGATTTGCCTGGTGAAATGAAAGTTCTTGTAAGCAAAGAAAAAA
    ACAAAGACGGCAAGTACGATCTAATTGCAACAGTAGACAAGCTTGAGCTTAAAGGAACTTCTGATAAAAA
    CAATGGATCTGGAGTACTTGAAGGCGTAAAAGCTGACAAAAGTAAAGTAAAATTAACAATTTCTGACGAT
    CTAGGTCAAACCACACTTGAAGTTTTCAAAGAAGATGGCAAAACACTAGTATCAAAAAAAGTAACTTCCA
    AAGACAAGTCATCAACAGAAGAAAAATTCAATGAAAAAGGTGAAGTATCTGAAAAAATAATAACAAGAGC
    AGACGGAACCAGACTTGAATACACAGGAATTAAAAGCGATGGATCTGGAAAAGCTAAAGAGGTTTTAAAA
    GGCTATGTTCTTGAAGGAACTCTAACTGCTGAAAAAACAACATTGGTGGTTAAAGAAGGAACTGTTACTT
    TAAGCAAAAATATTTCAAAATCTGGGGAAGTTTCAGTTGAACTTAATGACACTGACAGTAGTGCTGCTAC
    TAAAAAAACTGCAGCTTGGAATTCAGGCACTTCAACTTTAACAATTACTGTAAACAGTAAAAAAACTAAA
    GACCTTGTGTTTACAAAAGAAAACACAATTACAGTACAACAATACGACTCAAATGGCACCAAATTAGAGG
    GGTCAGCAGTTGAAATTACAAAACTTGATGAAATTAAAAACGCTTTAAAATA
  • Protein Sequence : Show Sequence
    >gi|11496927|ref|NP_045688.1| outer surface protein A (ospA) [Borrelia burgdorferi B31]
    MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKN
    NGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRA
    DGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAAT
    KKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice immunized with recombinant OspA protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994).
  • Related Vaccine(s): B. burgdorferi DbpA and OspA Protein Vaccine , B. burgdorferi DNA vaccine encoding strain B31 OspA , B. burgdorferi OspA Protein Vaccine
4. OspB
  • Gene Name : OspB
  • Sequence Strain (Species/Organism) : Borrelia burgdorferi B31
  • VO ID : VO_0012385
  • NCBI Gene ID : 1194340
  • NCBI Protein GI : 11496910
  • Locus Tag : BBA16
  • Genbank Accession : AE000790
  • Protein Accession : NP_045689
  • Taxonomy ID : 224326
  • Plasmid No : lp54
  • Gene Starting Position : 10223
  • Gene Ending Position : 11113
  • Gene Strand (Orientation) : ?
  • Protein Name : outer surface protein B (ospB)
  • Protein pI : 9.73
  • Protein Weight : 30130.112
  • Protein Length : 296
  • Protein Note : similar to GB:L23136 SP:P17739 GB:L23137 GB:L23138 GB:L23139 percent identity: 98.65; identified by sequence similarity; putative
  • DNA Sequence : Show Sequence
    >gi|11496892:10223-11113 Borrelia burgdorferi B31 plasmid lp54, complete sequence
    TATGAGATTATTAATAGGATTTGCTTTAGCGTTAGCTTTAATAGGATGTGCACAAAAAGGTGCTGAGTCA
    ATTGGTTCTCAAAAAGAAAATGATCTAAACCTTGAAGACTCTAGTAAAAAATCACATCAAAACGCTAAAC
    AAGACCTTCCTGCGGTGACAGAAGACTCAGTGTCTTTGTTTAATGGTAATAAAATTTTTGTAAGCAAAGA
    AAAAAATAGCTCCGGCAAATATGATTTAAGAGCAACAATTGATCAGGTTGAACTTAAAGGAACTTCCGAT
    AAAAACAATGGTTCTGGAACCCTTGAAGGTTCAAAGCCTGACAAGAGTAAAGTAAAATTAACAGTTTCTG
    CTGATTTAAACACAGTAACCTTAGAAGCATTTGATGCCAGCAACCAAAAAATTTCAAGTAAAGTTACTAA
    AAAACAGGGGTCAATAACAKAGGAAACTCTCAAAGCTAATAAATTAGACTCAAAGAAATTAACAAGATCA
    AACGGAACTACACTTGAATACTCACAAATAACAGATGCTGACAATGCTACAAAAGCAGTAGAAACTCTAA
    AAAATAGCATTAAGCTTGAAGGAAGTCTTGTAGGCGGAAAAACAACAGTGGAAATTAAAGAAGGTACTGT
    TACTCTAAAAAGAGAAATTGAAAAAGATGGAAAAGTAAAAGTCTTTTTGAATGACACTGCAGGTTCTAAC
    AAAAAAACAGGTAAATGGGAAGACAGTACTAGCACTTTAACAATTAGTGCTGACAGCAAAAAAACTAAAG
    ATTTGGTGTTCTTAACAGATGGTACAATTACAGTACAACAATACAACACAGCTGGAACCAGCCTAGAAGG
    ATCAGCAAGTGAAATTAAAAATCTTTCAGAGCTTAAAAACGCTTTAAAATA
  • Protein Sequence : Show Sequence
    >gi|11496910|ref|NP_045689.1| outer surface protein B (ospB) [Borrelia burgdorferi B31]
    MRLLIGFALALALIGCAQKGAESIGSQKENDLNLEDSSKKSHQNAKQDLPAVTEDSVSLFNGNKIFVSKE
    KNSSGKYDLRATIDQVELKGTSDKNNGSGTLEGSKPDKSKVKLTVSADLNTVTLEAFDASNQKISSKVTK
    KQGSITXETLKANKLDSKKLTRSNGTTLEYSQITDADNATKAVETLKNSIKLEGSLVGGKTTVEIKEGTV
    TLKREIEKDGKVKVFLNDTAGSNKKTGKWEDSTSTLTISADSKKTKDLVFLTDGTITVQQYNTAGTSLEG
    SASEIKNLSELKNALK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice immunized with recombinant OspB protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994).
  • Related Vaccine(s): B. burgdorferi OspB Protein Vaccine
5. OspC
  • Gene Name : OspC
  • Sequence Strain (Species/Organism) : Borrelia burgdorferi B31
  • VO ID : VO_0012386
  • NCBI Gene ID : 1194415
  • NCBI Protein GI : 11497024
  • Locus Tag : BBB19
  • Genbank Accession : AE000792
  • Protein Accession : NP_047005
  • 3D structure: PDB ID : 1GGQ
  • Taxonomy ID : 224326
  • Plasmid No : cp26
  • Gene Starting Position : 16902
  • Gene Ending Position : 17534
  • Gene Strand (Orientation) : ?
  • Protein Name : outer surface protein C (ospC)
  • Protein pI : 8.68
  • Protein Weight : 21347.6
  • Protein Length : 210
  • Protein Note : similar to GB:AE000792 percent identity: 100.00; identified by sequence similarity; putative
  • DNA Sequence : Show Sequence
    >gi|11497007:16902-17534 Borrelia burgdorferi plasmid cp26, complete sequence
    AATGAAAAAGAATACATTAAGTGCAATATTAATGACTTTATTTTTATTTATATCTTGTAATAATTCAGGG
    AAAGATGGGAATACATCTGCAAATTCTGCTGATGAGTCTGTTAAAGGGCCTAATCTTACAGAAATAAGTA
    AAAAAATTACGGATTCTAATGCGGTTTTACTTGCTGTGAAAGAGGTTGAAGCGTTGCTGTCATCTATAGA
    TGAAATTGCTGCTAAAGCTATTGGTAAAAAAATACACCAAAATAATGGTTTGGATACCGAAAATAATCAC
    AATGGATCATTGTTAGCGGGAGCTTATGCAATATCAACCCTAATAAAACAAAAATTAGATGGATTGAAAA
    ATGAAGGATTAAAGGAAAAAATTGATGCGGCTAAGAAATGTTCTGAAACATTTACTAATAAATTAAAAGA
    AAAACACACAGATCTTGGTAAAGAAGGTGTTACTGATGCTGATGCAAAAGAAGCCATTTTAAAAACAAAT
    GGTACTAAAACTAAAGGTGCTGAAGAACTTGGAAAATTATTTGAATCAGTAGAGGTCTTGTCAAAAGCAG
    CTAAAGAGATGCTTGCTAATTCAGTTAAAGAGCTTACAAGCCCTGTTGTGGCAGAAAGTCCAAAAAAACC
    TTA
  • Protein Sequence : Show Sequence
    >gi|11497024|ref|NP_047005.1| outer surface protein C (ospC) [Borrelia burgdorferi B31]
    MKKNTLSAILMTLFLFISCNNSGKDGNTSANSADESVKGPNLTEISKKITDSNAVLLAVKEVEALLSSID
    EIAAKAIGKKIHQNNGLDTENNHNGSLLAGAYAISTLIKQKLDGLKNEGLKEKIDAAKKCSETFTNKLKE
    KHTDLGKEGVTDADAKEAILKTNGTKTKGAEELGKLFESVEVLSKAAKEMLANSVKELTSPVVAESPKKP
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice immunized with recombinant OspC protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994).
  • Related Vaccine(s): B. burgdorferi DNA vaccine pCMV-ZS7/TPA encoding OspC from Borrelia burgdorferi sensu lato , B. burgdorferi OspC Protein Vaccine
III. Vaccine Information
1. B. burgdorferi DbpA and OspA Protein Vaccine
a. Vaccine Ontology ID:
VO_0004188
b. Type:
Subunit vaccine
c. Status:
Research
d. Antigen
DbpAN40-OspAN40
e. Gene Engineering of DbpA
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
f. Gene Engineering of OspA
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
g. Adjuvant: complete Freunds adjuvant
h. Adjuvant: incomplete Freunds adjuvant
i. Immunization Route
Intraperitoneal injection (i.p.)
j. Mouse Response
  • Host Strain: C3H/HeJ
  • Vaccination Protocol: Mice were immunized by intraperitoneal injection of 10 μg of DbpAN40, 10 μg of OspAN40, 5 μg of DbpAN40 plus 5 μg of OspAN40, or 2.5 μg of E. coli protein extract with complete Freund's adjuvant and then, 4 weeks later, were given a second immunization of protein in incomplete Freund's adjuvant (Hanson et al., 2000).
  • Challenge Protocol: At week 6, five of the mice in each immunization group were challenged by subcutaneous injection, into the dorsolateral thorax, of cloned B. burgdorferi N40 (Hanson et al., 2000).
  • Efficacy: All mice immunized with the combined DbpAN40-OspAN40 vaccine (5 μg of each antigen) were protected against even the highest challenge dose of 106 spirochetes (Hanson et al., 2000).
2. B. burgdorferi DbpA Protein Vaccine
a. Vaccine Ontology ID:
VO_0004027
b. Type:
Subunit vaccine
c. Status:
Research
d. Antigen
The recombinant fusion lipoprotein pp2:DbpAN40(His)6 (DbpAN40) (Hanson et al., 2000).
e. Gene Engineering of DbpA
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
f. Adjuvant: complete Freunds adjuvant
g. Adjuvant: incomplete Freunds adjuvant
h. Immunization Route
Intraperitoneal injection (i.p.)
i. Mouse Response
  • Host Strain: C3H/HeJ
  • Vaccination Protocol: Mice were immunized by intraperitoneal injection of 10 μg of DbpAN40, 10 μg of OspAN40, 5 μg of DbpAN40 plus 5 μg of OspAN40, or 2.5 μg of E. coli protein extract with complete Freund's adjuvant and then, 4 weeks later, were given a second immunization of protein in incomplete Freund's adjuvant (Hanson et al., 2000).
  • Challenge Protocol: At week 6, five of the mice in each immunization group were challenged by subcutaneous injection, into the dorsolateral thorax, of cloned B. burgdorferi N40 (Hanson et al., 2000).
  • Efficacy: Mice immunized with recombinant DbpA protein are protected against challenge with Borrelia burgdorferi. Nearly all mice immunized with 10 μg of DbpAN40 were protected from challenge with 103 or 104 spirochetes (Hanson et al., 2000).
3. B. burgdorferi DNA vaccine encoding strain B31 OspA
a. Vaccine Ontology ID:
VO_0004513
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of OspA
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
VR2210 (Luke et al., 1997)
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
  • Vaccination Protocol: Female C3H/HeN mice (6-10 weeks old) were injected with plasmid diluted in sterile 0.9% saline. Each mouse received intramuscular injections into left and right rectus femoris muscles with 50 J-lg of plasmid in 50 J-lL of saline. For immunization with protein, mice were injected in the back with purified B31 rOspA lipoprotein (Luke et al., 1997).
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Sera from mice immunized with the ospA-bearing plasmid DNA had high levels of antibody that recognized both native and rOspA lipoprotein (Luke et al., 1997).
  • Challenge Protocol: Mice were challenged intradermally by injecting 100 x ID50 of the infectious isolate at the base of the tail (Luke et al., 1997).
  • Efficacy: Immunization with VR2210 protected 100% of mice against infection with Sh-2-82 or N40, 2 infectious strains of B. burgdorferi (Luke et al., 1997).
4. B. burgdorferi DNA vaccine pCMV-ZS7/TPA encoding OspC from Borrelia burgdorferi sensu lato
a. Vaccine Ontology ID:
VO_0004413
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of OspC
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
pCMV-TPA/ZS7 (Scheiblhofer et al., 2003)
g. Immunization Route
Intradermal injection (i.d.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Both i.d. injection and gene-gun application of plasmid DNA encoding the ospC gene induced a reliable humoral response with high antibody titers, antigen-specific cellular responses and, most importantly, provided effective protection (Scheiblhofer et al., 2003).
  • Challenge Protocol: Control groups received challenge doses B. burgdorferi strain ZS7 of 104, 103, 102, and 10 live spirochetes per animal (Scheiblhofer et al., 2003).
  • Efficacy: The protection rate after challenge with 10 B. burgdorferi organisms per mouse was between 80% and 100% for all groups. These results demonstrate that a DNA vaccine encoding OspC of B. burgdorferi is suitable for inducing protection against Lyme borreliosis (Scheiblhofer et al., 2003).
5. B. burgdorferi OspA Protein Vaccine
a. Vaccine Ontology ID:
VO_0004028
b. Type:
Subunit vaccine
c. Status:
Research
d. Antigen
Recombinant OspA protein
e. Gene Engineering of OspA
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
f. Adjuvant: complete Freunds adjuvant
g. Adjuvant: incomplete Freunds adjuvant
h. Immunization Route
Intraperitoneal injection (i.p.)
i. Mouse Response
  • Host Strain: C3H/HeN
  • Vaccination Protocol: Four-week-old female mice were primed intraperitoneally with 20 μg of each immunogen in 200 μL of complete Freund's adjuvant. Three boosts containing the same amount of immunogen in incomplete Freund's adjuvant were administered at 2, 5, and 8 weeks following the initial injection (Probert and LeFebvre, 1994).
  • Challenge Protocol: Ten days following the final boost, mice received a subcutaneous inoculation containing 107 SON 188 organisms in 100 μl of BSK II medium (Probert and LeFebvre, 1994).
  • Efficacy: Mice immunized with recombinant OspA protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994).
6. B. burgdorferi OspB Protein Vaccine
a. Vaccine Ontology ID:
VO_0004029
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Antigen
Recombinant OspB protein
e. Gene Engineering of OspB
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
f. Adjuvant: complete Freunds adjuvant
g. Adjuvant: incomplete Freunds adjuvant
h. Immunization Route
Intraperitoneal injection (i.p.)
i. Mouse Response
  • Host Strain: C3H/HeN
  • Vaccination Protocol: Four-week-old female mice were primed intraperitoneally with 20 μg of each immunogen in 200 μL of complete Freund's adjuvant. Three boosts containing the same amount of immunogen in incomplete Freund's adjuvant were administered at 2, 5, and 8 weeks following the initial injection (Probert and LeFebvre, 1994).
  • Challenge Protocol: Ten days following the final boost, mice received a subcutaneous inoculation containing 107 SON 188 organisms in 100 μl of BSK II medium (Probert and LeFebvre, 1994).
  • Efficacy: Mice immunized with recombinant OspB protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994).
7. B. burgdorferi OspC Protein Vaccine
a. Vaccine Ontology ID:
VO_0004030
b. Type:
Subunit vaccine
c. Status:
Research
d. Antigen
Recombinant OspC protein
e. Gene Engineering of OspC
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
f. Adjuvant: complete Freunds adjuvant
g. Adjuvant: incomplete Freunds adjuvant
h. Immunization Route
Intraperitoneal injection (i.p.)
i. Mouse Response
  • Host Strain: C3H/HeN
  • Vaccination Protocol: Four-week-old female mice were primed intraperitoneally with 20 μg of each immunogen in 200 μL of complete Freund's adjuvant. Three boosts containing the same amount of immunogen in incomplete Freund's adjuvant were administered at 2, 5, and 8 weeks following the initial injection (Probert and LeFebvre, 1994).
  • Challenge Protocol: Ten days following the final boost, mice received a subcutaneous inoculation containing 107 SON 188 organisms in 100 μl of BSK II medium (Probert and LeFebvre, 1994).
  • Efficacy: Mice immunized with recombinant OspC protein were protected from challenge with Borrelia burgdorferi (Hanson et al., 1998).
8. Borrelia burgdorferi fla mutant vaccine
a. Vaccine Ontology ID:
VO_0002809
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of fla
f. Immunization Route
Intradermal injection (i.d.)
g. Mouse Response
  • Persistence: A fla mutant is attenuated in SCID mice (Sadziene et al., 1996).
  • Efficacy: A fla mutant induces protection in mice from challenge with wild type B. burgdorferi 28 days after inoculation (Sadziene et al., 1996).
9. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47A5.20)
a. Manufacturer:
Wyeth, Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002239
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
10. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 47E5.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002244
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
11. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 47E5.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002243
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
12. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002241
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
13. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.29)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002242
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
14. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46B9.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002219
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
IV. References
1. Hanson et al., 1998: Hanson MS, Cassatt DR, Guo BP, Patel NK, McCarthy MP, Dorward DW, Höök M. Active and passive immunity against Borrelia burgdorferi decorin binding protein A (DbpA) protects against infection. Infection and immunity. 1998; 66(5); 2143-2153. [PubMed: 9573101].
2. Hanson et al., 2000: Hanson MS, Patel NK, Cassatt DR, Ulbrandt ND. Evidence for vaccine synergy between Borrelia burgdorferi decorin binding protein A and outer surface protein A in the mouse model of lyme borreliosis. Infection and immunity. 2000; 68(11); 6457-6460. [PubMed: 11035759].
3. Probert and LeFebvre, 1994: Probert WS, LeFebvre RB. Protection of C3H/HeN mice from challenge with Borrelia burgdorferi through active immunization with OspA, OspB, or OspC, but not with OspD or the 83-kilodalton antigen. Infection and immunity. 1994; 62(5); 1920-1926. [PubMed: 8168958].
4. Sadziene et al., 1996: Sadziene A, Thompson PA, Barbour AG. A flagella-less mutant of Borrelia burgdorferi as a live attenuated vaccine in the murine model of Lyme disease. The Journal of infectious diseases. 1996; 173(5); 1184-1193. [PubMed: 8627071].
5. Salyers and Whitt., 2002: Abigail A. Salyers, Dixie D. Whitt. The Spirochetes: Borrelia burgdorferi and Treponema pallidum. 187-199. Bacterial Pathogenesis: A Molecular Approach. 2002. ASM Press, Washington D.C. USA.
6. Wiki: B. burgdorferi: Wiki: Borrelia burgdorferi [http://en.wikipedia.org/wiki/Borrelia_burgdorferi]