VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Listeria monocytogenes

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. Hly (Protective antigen)
    2. p60 (Protective antigen)
    3. actA (Virmugen)
    4. plcB (Virmugen)
  3. Vaccine Related Host Genes
    1. Ifng (Interferon gamma)
  4. Vaccine Information
    1. L. monocytogenes DNA Vaccine encoding hly
    2. L. monocytogenes p60 Protein Vaccine
    3. Listeria monocytogenes actA mutant vaccine
    4. Listeria monocytogenes actA/plcB mutant vaccine
  5. References
I. General Information
1. NCBI Taxonomy ID:
1639
2. Disease:
Listeriosis
3. Introduction
Listeria monocytogenes is a gram positive facultatively intracellular foodborne pathogen, which is often found in food and elsewhere in nature. Listeria can survive temperatures from below freezing to body temperature (Ramaswamy et al., 2007). Infection by L. monocytogenes causes the disease listeriosis. The manifestations of listeriosis include septicemia, meningitis (or meningoencephalitis), encephalitis, corneal ulcer, pneumonia, and intrauterine or cervical infections in pregnant women, which may result in spontaneous abortion (2nd/3rd trimester) or stillbirth (Wiki: L. monocytogenes).
4. Microbial Pathogenesis
L. monocytogenes may invade the gastrointestinal epithelium. Once the bacterium enters the host's monocytes, macrophages, or polymorphonuclear leukocytes, it becomes blood-borne (septicemic) and can grow. Its presence intracellularly in phagocytic cells also permits access to the brain and probably transplacental migration to the fetus in pregnant women. The pathogenesis of L. monocytogenes centers on its ability to survive and multiply in phagocytic host cells (Wiki: L. monocytogenes). Listeria is able to move from cell to cell via actin motility (Ramaswamy et al., 2007).
5. Host Ranges and Animal Models
Listeria can live in the intestines of humans, animals and birds without causing symptoms. Mice are used as a model of infection for listeria (Ramaswamy et al., 2007).
6. Host Protective Immunity
Infection is often controlled by cell mediated response. Infection is asymptomatic in most patients, and tends to be more severe in immunocompromised individuals (Ramaswamy et al., 2007).
1. actA
  • Gene Name : actA
  • Sequence Strain (Species/Organism) : Listeria monocytogenes EGD-e
  • NCBI Gene ID : 987035
  • NCBI Protein GI : 16802250
  • Locus Tag : lmo0204
  • Genbank Accession : AL591974
  • Protein Accession : NP_463735
  • 3D structure: PDB ID : 1EVH
  • Taxonomy ID : 169963
  • Gene Starting Position : 209469
  • Gene Ending Position : 211388
  • Gene Strand (Orientation) : +
  • Protein Name : actin-assembly inducing protein precursor
  • Protein pI : 4.71
  • Protein Weight : 68063.81
  • Protein Length : 639
  • DNA Sequence : Show Sequence
    >gi|16802048:209469-211388 Listeria monocytogenes EGD-e, complete genome
    AGTGGGATTAAACAGATTTATGCGTGCGATGATGGTGGTTTTCATTACTGCCAATTGCATTACGATTAAC
    CCCGACATAATATTTGCAGCGACAGATAGCGAAGATTCTAGTCTAAACACAGATGAATGGGAAGAAGAAA
    AAACAGAAGAGCAACCAAGCGAGGTAAATACGGGACCAAGATACGAAACTGCACGTGAAGTAAGTTCACG
    TGATATTAAAGAACTAGAAAAATCGAATAAAGTGAGAAATACGAACAAAGCAGACCTAATAGCAATGTTG
    AAAGAAAAAGCAGAAAAAGGTCCAAATATCAATAATAACAACAGTGAACAAACTGAGAATGCGGCTATAA
    ATGAAGAGGCTTCAGGAGCCGACCGACCAGCTATACAAGTGGAGCGTCGTCATCCAGGATTGCCATCGGA
    TAGCGCAGCGGAAATTAAAAAAAGAAGGAAAGCCATAGCATCATCGGATAGTGAGCTTGAAAGCCTTACT
    TATCCGGATAAACCAACAAAAGTAAATAAGAAAAAAGTGGCGAAAGAGTCAGTTGCGGATGCTTCTGAAA
    GTGACTTAGATTCTAGCATGCAGTCAGCAGATGAGTCTTCACCACAACCTTTAAAAGCAAACCAACAACC
    ATTTTTCCCTAAAGTATTTAAAAAAATAAAAGATGCGGGGAAATGGGTACGTGATAAAATCGACGAAAAT
    CCTGAAGTAAAGAAAGCGATTGTTGATAAAAGTGCAGGGTTAATTGACCAATTATTAACCAAAAAGAAAA
    GTGAAGAGGTAAATGCTTCGGACTTCCCGCCACCACCTACGGATGAAGAGTTAAGACTTGCTTTGCCAGA
    GACACCAATGCTTCTTGGTTTTAATGCTCCTGCTACATCAGAACCGAGCTCATTCGAATTTCCACCACCA
    CCTACGGATGAAGAGTTAAGACTTGCTTTGCCAGAGACGCCAATGCTTCTTGGTTTTAATGCTCCTGCTA
    CATCGGAACCGAGCTCGTTCGAATTTCCACCGCCTCCAACAGAAGATGAACTAGAAATCATCCGGGAAAC
    AGCATCCTCGCTAGATTCTAGTTTTACAAGAGGGGATTTAGCTAGTTTGAGAAATGCTATTAATCGCCAT
    AGTCAAAATTTCTCTGATTTCCCACCAATCCCAACAGAAGAAGAGTTGAACGGGAGAGGCGGTAGACCAA
    CATCTGAAGAATTTAGTTCGCTGAATAGTGGTGATTTTACAGATGACGAAAACAGCGAGACAACAGAAGA
    AGAAATTGATCGCCTAGCTGATTTAAGAGATAGAGGAACAGGAAAACACTCAAGAAATGCGGGTTTTTTA
    CCATTAAATCCGTTTGCTAGCAGCCCGGTTCCTTCGTTAAGTCCAAAGGTATCGAAAATAAGCGCACCGG
    CTCTGATAAGTGACATAACTAAAAAAACGCCATTTAAGAATCCATCACAGCCATTAAATGTGTTTAATAA
    AAAAACTACAACGAAAACAGTGACTAAAAAACCAACCCCTGTAAAGACCGCACCAAAGCTAGCAGAACTT
    CCTGCCACAAAACCACAAGAAACCGTACTTAGGGAAAATAAAACACCCTTTATAGAAAAACAAGCAGAAA
    CAAACAAGCAGTCAATTAATATGCCGAGCCTACCAGTAATCCAAAAAGAAGCTACAGAGAGCGATAAAGA
    GGAAATGAAACCACAAACCGAGGAAAAAATGGTAGAGGAAAGCGAATCAGCTAATAACGCAAACGGAAAA
    AATCGTTCTGCTGGCATTGAAGAAGGAAAACTAATTGCTAAAAGTGCAGAAGACGAAAAAGCGAAGGAAG
    AACCAGGGAACCATACGACGTTAATTCTTGCAATGTTAGCTATTGGCGTGTTCTCTTTAGGGGCGTTTAT
    CAAAATTATTCAATTAAGAAAAAATAATTA
  • Protein Sequence : Show Sequence
    >gi|16802250|ref|NP_463735.1| actin-assembly inducing protein precursor [Listeria monocytogenes EGD-e]
    MGLNRFMRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEEEKTEEQPSEVNTGPRYETAREVSSR
    DIKELEKSNKVRNTNKADLIAMLKEKAEKGPNINNNNSEQTENAAINEEASGADRPAIQVERRHPGLPSD
    SAAEIKKRRKAIASSDSELESLTYPDKPTKVNKKKVAKESVADASESDLDSSMQSADESSPQPLKANQQP
    FFPKVFKKIKDAGKWVRDKIDENPEVKKAIVDKSAGLIDQLLTKKKSEEVNASDFPPPPTDEELRLALPE
    TPMLLGFNAPATSEPSSFEFPPPPTDEELRLALPETPMLLGFNAPATSEPSSFEFPPPPTEDELEIIRET
    ASSLDSSFTRGDLASLRNAINRHSQNFSDFPPIPTEEELNGRGGRPTSEEFSSLNSGDFTDDENSETTEE
    EIDRLADLRDRGTGKHSRNAGFLPLNPFASSPVPSLSPKVSKISAPALISDITKKTPFKNPSQPLNVFNK
    KTTTKTVTKKPTPVKTAPKLAELPATKPQETVLRENKTPFIEKQAETNKQSINMPSLPVIQKEATESDKE
    EMKPQTEEKMVEESESANNANGKNRSAGIEEGKLIAKSAEDEKAKEEPGNHTTLILAMLAIGVFSLGAFI
    KIIQLRKNN
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An actA mutant is attenuated in mice and induced significant protection from challenge with wild type L. monocytogenes (Darji et al., 2003).
  • Related Vaccine(s): Listeria monocytogenes actA mutant vaccine , Listeria monocytogenes actA/plcB mutant vaccine
2. Hly
  • Gene Name : Hly
  • Sequence Strain (Species/Organism) : Listeria monocytogenes EGD-e
  • VO ID : VO_0012388
  • NCBI Gene ID : 987033
  • NCBI Protein GI : 16802248
  • Locus Tag : lmo0202
  • Genbank Accession : AL591974
  • Protein Accession : NP_463733
  • Taxonomy ID : 169963
  • Gene Starting Position : 205818
  • Gene Ending Position : 207407
  • Gene Strand (Orientation) : +
  • Protein Name : listeriolysin O precursor
  • Protein pI : 8.23
  • Protein Weight : 54322.11
  • Protein Length : 529
  • DNA Sequence : Show Sequence
    >gi|16802048:205818-207407 Listeria monocytogenes EGD-e, complete genome
    CATGAAAAAAATAATGCTAGTTTTTATTACACTTATATTAGTTAGTCTACCAATTGCGCAACAAACTGAA
    GCAAAGGATGCATCTGCATTCAATAAAGAAAATTCAATTTCATCCATGGCACCACCAGCATCTCCGCCTG
    CAAGTCCTAAGACGCCAATCGAAAAGAAACACGCGGATGAAATCGATAAGTATATACAAGGATTGGATTA
    CAATAAAAACAATGTATTAGTATACCACGGAGATGCAGTGACAAATGTGCCGCCAAGAAAAGGTTACAAA
    GATGGAAATGAATATATTGTTGTGGAGAAAAAGAAGAAATCCATCAATCAAAATAATGCAGACATTCAAG
    TTGTGAATGCAATTTCGAGCCTAACCTATCCAGGTGCTCTCGTAAAAGCGAATTCGGAATTAGTAGAAAA
    TCAACCAGATGTTCTCCCTGTAAAACGTGATTCATTAACACTCAGCATTGATTTGCCAGGTATGACTAAT
    CAAGACAATAAAATCGTTGTAAAAAATGCCACTAAATCAAACGTTAACAACGCAGTAAATACATTAGTGG
    AAAGATGGAATGAAAAATATGCTCAAGCTTATCCAAATGTAAGTGCAAAAATTGATTATGATGACGAAAT
    GGCTTACAGTGAATCACAATTAATTGCGAAATTTGGTACAGCATTTAAAGCTGTAAATAATAGCTTGAAT
    GTAAACTTCGGCGCAATCAGTGAAGGGAAAATGCAAGAAGAAGTCATTAGTTTTAAACAAATTTACTATA
    ACGTGAATGTTAATGAACCTACAAGACCTTCCAGATTTTTCGGCAAAGCTGTTACTAAAGAGCAGTTGCA
    AGCGCTTGGAGTGAATGCAGAAAATCCTCCTGCATATATCTCAAGTGTGGCGTATGGCCGTCAAGTTTAT
    TTGAAATTATCAACTAATTCCCATAGTACTAAAGTAAAAGCTGCTTTTGATGCTGCCGTAAGCGGAAAAT
    CTGTCTCAGGTGATGTAGAACTAACAAATATCATCAAAAATTCTTCCTTCAAAGCCGTAATTTACGGAGG
    TTCCGCAAAAGATGAAGTTCAAATCATCGACGGCAACCTCGGAGACTTACGCGATATTTTGAAAAAAGGC
    GCTACTTTTAATCGAGAAACACCAGGAGTTCCCATTGCTTATACAACAAACTTCCTAAAAGACAATGAAT
    TAGCTGTTATTAAAAACAACTCAGAATATATTGAAACAACTTCAAAAGCTTATACAGATGGAAAAATTAA
    CATCGATCACTCTGGAGGATACGTTGCTCAATTCAACATTTCTTGGGATGAAGTAAATTATGATCCTGAA
    GGTAACGAAATTGTTCAACATAAAAACTGGAGCGAAAACAATAAAAGCAAGCTAGCTCATTTCACATCGT
    CCATCTATTTGCCAGGTAACGCGAGAAATATTAATGTTTACGCTAAAGAATGCACTGGTTTAGCTTGGGA
    ATGGTGGAGAACGGTAATTGATGACCGGAACTTACCACTTGTGAAAAATAGAAATATCTCCATCTGGGGC
    ACCACGCTTTATCCGAAATATAGTAATAAAGTAGATAATCCAATCGAATA
  • Protein Sequence : Show Sequence
    >gi|16802248|ref|NP_463733.1| listeriolysin O precursor [Listeria monocytogenes EGD-e]
    MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDY
    NKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVEN
    QPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEM
    AYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQ
    ALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGG
    SAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKIN
    IDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWE
    WWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : In an attempt to generate a subunit vaccine in this experimental disease model, eukaryotic plasmid DNA expression vectors containing genes encoding either the wild-type or modified forms of recombinant listeriolysin O (hly) were generated and used for genetic vaccination of naive mice. Results of these studies indicate that the intramuscular immunization of mice with specifically designed plasmid DNA constructs encoding recombinant forms of listeriolysin O (hly) stimulates peptide-specific CD8+ immune T cells that exhibit in vitro cytotoxic activity. More importantly, such immunization can provide protective immunity against a subsequent challenge with viable L. monocytogenes (Cornell et al., 1999).
  • Related Vaccine(s): L. monocytogenes DNA Vaccine encoding hly
3. p60
  • Gene Name : p60
  • Sequence Strain (Species/Organism) : Listeria monocytogenes strain L2K3-549C1
  • VO ID : VO_0012404
  • NCBI Protein GI : 215422507
  • Other Database IDs : CDD:172430
  • Taxonomy ID : 1639
  • Gene Strand (Orientation) : ?
  • Protein Name : p60
  • Protein Length : 129
  • Protein Note : invasion associated secreted endopeptidase; Provisional; PRK13914
  • Protein Sequence : Show Sequence
    >gi|215422507|dbj|BAG85375.1| p60 [Listeria monocytogenes]
    MSWNNLSSSSIYVGQKLAIKQTANTVTPKAEVKKEAPAAEKQAAPVVKENTNTNTNTTTEKKETTQQQTA
    PKAPTEAAKPAPAPSTNTNANKTNTNTNNTNTSTPSKNTNTNTNSNTNTNSNTNANQGS
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice immunized with p60 encapsulated in liposomes launched a strong CTL response and were protected against a subsequent challenge with L. monocytogenes (Grenningloh et al., 2008).
  • Related Vaccine(s): L. monocytogenes p60 Protein Vaccine
4. plcB
  • Gene Name : plcB
  • Sequence Strain (Species/Organism) : Listeria monocytogenes EGD-e
  • NCBI Gene ID : 987036
  • NCBI Protein GI : 16802251
  • Locus Tag : lmo0205
  • Genbank Accession : AL591974
  • Protein Accession : NP_463736
  • Taxonomy ID : 169963
  • Gene Starting Position : 211424
  • Gene Ending Position : 212293
  • Gene Strand (Orientation) : +
  • Protein Name : phospholipase C
  • Protein pI : 8.4
  • Protein Weight : 31887.47
  • Protein Length : 289
  • DNA Sequence : Show Sequence
    >gi|16802048:211424-212293 Listeria monocytogenes EGD-e, complete genome
    TATGAAATTCAAAAAGGTGGTTCTAGGTATGTGCTTGATCGCAAGTGTTCTAGTCTTTCCGGTAACGATA
    AAAGCAAATGCCTGTTGTGATGAATACTTACAAACACCCGCAGCTCCGCATGATATTGACAGCAAATTAC
    CACATAAACTTAGTTGGTCCGCGGATAACCCGACAAATACTGACGTAAATACGCACTATTGGCTTTTTAA
    ACAAGCGGAAAAAATACTAGCTAAAGATGTAAATCATATGCGAGCTAATTTAATGAATGAACTTAAAAAA
    TTCGATAAACAAATAGCTCAAGGAATATATGATGCGGATCATAAAAATCCATATTATGATACTAGTACAT
    TTTTATCTCATTTTTATAATCCTGATAGAGATAATACTTATTTGCCGGGTTTTGCTAATGCGAAAATAAC
    AGGAGCAAAGTATTTCAATCAATCGGTGACTGATTACCGAGAAGGGAAATTTGACACAGCGTTTTATAAA
    TTAGGCCTAGCAATCCATTATTATACGGATATTAGTCAACCTATGCACGCCAATAATTTTACCGCAATAT
    CATACCCTCCAGGCTACCACTGTGCATATGAAAATTACGTAGATACCATTAAACACAATTATCAAGCAAC
    GGAAGACATGGTAGCAAAAAGATTTTGCTCAGATGACGTGAAAGACTGGCTCTATGAAAATGCGAAAAGG
    GCGAAAGCGGACTACCCGAAAATAGTCAATGCGAAAACTAAAAAATCATATTTAGTAGGAAATTCTGAAT
    GGAAAAAGGATACAGTGGAACCTACTGGAGCTAGACTAAGAGATTCACAGCAAACTTTGGCAGGTTTTTT
    AGAATTTTGGTCTAAAAAAACAAATGAATA
  • Protein Sequence : Show Sequence
    >gi|16802251|ref|NP_463736.1| phospholipase C [Listeria monocytogenes EGD-e]
    MKFKKVVLGMCLIASVLVFPVTIKANACCDEYLQTPAAPHDIDSKLPHKLSWSADNPTNTDVNTHYWLFK
    QAEKILAKDVNHMRANLMNELKKFDKQIAQGIYDADHKNPYYDTSTFLSHFYNPDRDNTYLPGFANAKIT
    GAKYFNQSVTDYREGKFDTAFYKLGLAIHYYTDISQPMHANNFTAISYPPGYHCAYENYVDTIKHNYQAT
    EDMVAKRFCSDDVKDWLYENAKRAKADYPKIVNAKTKKSYLVGNSEWKKDTVEPTGARLRDSQQTLAGFL
    EFWSKKTNE
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A plcB mutant, in combination with an actA mutant, is attenuated in mice and induces significant protection from challenge with wild type L. monocytogenes (Darji et al., 2003).
  • Related Vaccine(s): Listeria monocytogenes actA/plcB mutant vaccine
1. Ifng (Interferon gamma)
  • Gene Name : Ifng (Interferon gamma)
  • Sequence Strain (Species/Organism) : Mouse
  • NCBI Gene ID : 15978
  • NCBI Protein GI : 33468859
  • Genbank Accession : NM_008337
  • Protein Accession : NP_032363.1
  • Other Database IDs : MGI:107656; UniProt: P01580
  • Taxonomy ID : 10090
  • Gene Strand (Orientation) : ?
  • DNA Sequence : Show Sequence
    >gi|145966741|ref|NM_008337.3| Mus musculus interferon gamma (Ifng), mRNA
    ATAGCTGCCATCGGCTGACCTAGAGAAGACACATCAGCTGATCCTTTGGACCCTCTGACTTGAGACAGAA
    GTTCTGGGCTTCTCCTCCTGCGGCCTAGCTCTGAGACAATGAACGCTACACACTGCATCTTGGCTTTGCA
    GCTCTTCCTCATGGCTGTTTCTGGCTGTTACTGCCACGGCACAGTCATTGAAAGCCTAGAAAGTCTGAAT
    AACTATTTTAACTCAAGTGGCATAGATGTGGAAGAAAAGAGTCTCTTCTTGGATATCTGGAGGAACTGGC
    AAAAGGATGGTGACATGAAAATCCTGCAGAGCCAGATTATCTCTTTCTACCTCAGACTCTTTGAAGTCTT
    GAAAGACAATCAGGCCATCAGCAACAACATAAGCGTCATTGAATCACACCTGATTACTACCTTCTTCAGC
    AACAGCAAGGCGAAAAAGGATGCATTCATGAGTATTGCCAAGTTTGAGGTCAACAACCCACAGGTCCAGC
    GCCAAGCATTCAATGAGCTCATCCGAGTGGTCCACCAGCTGTTGCCGGAATCCAGCCTCAGGAAGCGGAA
    AAGGAGTCGCTGCTGATTCGGGGTGGGGAAGAGATTGTCCCAATAAGAATAATTCTGCCAGCACTATTTG
    AATTTTTAAATCTAAACCTATTTATTAATATTTAAAACTATTTATATGGAGAATCTATTTTAGATGCATC
    AACCAAAGAAGTATTTATAGTAACAACTTATATGTGATAAGAGTGAATTCCTATTAATATATGTGTTATT
    TATAATTTCTGTCTCCTCAACTATTTCTCTTTGACCAATTAATTATTCTTTCTGACTAATTAGCCAAGAC
    TGTGATTGCGGGGTTGTATCTGGGGGTGGGGGACAGCCAAGCGGCTGACTGAACTCAGATTGTAGCTTGT
    ACCTTTACTTCACTGACCAATAAGAAACATTCAGAGCTGCAGTGACCCCGGGAGGTGCTGCTGATGGGAG
    GAGATGTCTACACTCCGGGCCAGCGCTTTAACAGCAGGCCAGACAGCACTCGAATGTGTCAGGTAGTAAC
    AGGCTGTCCCTGAAAGAAAGCAGTGTCTCAAGAGACTTGACACCTGGTGCTTCCCTATACAGCTGAAAAC
    TGTGACTACACCCGAATGACAAATAACTCGCTCATTTATAGTTTATCACTGTCTAATTGCATATGAATAA
    AGTATACCTTTGCAACC
  • Protein Sequence : Show Sequence
    >gi|33468859|ref|NP_032363.1| interferon gamma [Mus musculus]
    MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQI
    ISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQ
    LLPESSLRKRKRSRC
  • Molecule Role Annotation : IFN-gamma plays a critical role in Th1 type immune response. It is important for protection against infections by various viruses and intracellular bacteria.
  • Additional Molecule Role : Vaximmutor
  • Additional Molecule Role Annotation : The experimental data demonstrated that three time vaccinations with BCG in BALB/c mice induced strong TB Ag-specific IFN-gamma immune responses in splenocytes (Wang et al., 2009).
  • Related Vaccine(s): Listeria monocytogenes actA/plcB mutant vaccine
IV. Vaccine Information
1. L. monocytogenes DNA Vaccine encoding hly
a. Vaccine Ontology ID:
VO_0004031
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
The hly gene of L. monocytogenes
e. Gene Engineering of Hly
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
pCR3.1 plasmid vector (Invitrogen)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: For immunization with the plasmid constructs, 6-to 8-wk-old mice received the first of a series of three i.m. immunizations (via the tibialis anterior muscles) at 3- to 4-wk intervals with ~100–125 µg of plasmid DNA in 50 µl of normal saline. Normal control mice received either no immunization or were immunized with either 0.2 ml of PBS (i.v.) or 50 µl of saline (i.m.) (Cornell et al., 1999).
  • Challenge Protocol: Briefly, groups of normal or immunized BALB/c mice received an i.v. injection with ~2 LD50 (~20,000 CFU) of L. monocytogenes in 0.2 ml of PBS, at 3–4 wk following the final immunization with plasmid DNA. Control groups consisted of normal (nonimmunized) mice and mice previously immunized (4–12 wk earlier) with a sublethal injection of viable L. monocytogenes (Cornell et al., 1999).
  • Efficacy: DNA immunization of mice provides protection against challenge with viable L. monocytogenes (Cornell et al., 1999).
2. L. monocytogenes p60 Protein Vaccine
a. Vaccine Ontology ID:
VO_0004032
b. Type:
Subunit vaccine
c. Status:
Research
d. Antigen
p60 protein
e. Gene Engineering of p60
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
f. Adjuvant: liposome-based vaccine adjuvant
g. Immunization Route
Intraperitoneal injection (i.p.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: BALB/c mice (two mice/group) were immunized i.p. with 100 μl liposomes containing approximately 3 μg of p60 antigen shown (Grenningloh et al., 2008).
  • Challenge Protocol: BALB/c mice were immunized with encapsulated p60 and challenged intravenously on day 9 after immunization with 5 × 103 (1 × LD50) L. monocytogenes (Grenningloh et al., 2008).
  • Efficacy: Mice immunized with p60 encapsulated in liposomes launched a strong CTL response and were protected against a subsequent challenge with L. monocytogenes (Grenningloh et al., 2008).
3. Listeria monocytogenes actA mutant vaccine
a. Vaccine Ontology ID:
VO_0002776
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of actA
  • Type: Gene mutation
  • Description: This actA mutant is from Listeria monocytogenes (Darji et al., 2003).
  • Detailed Gene Information: Click here.
f. Immunization Route
Intravenous injection (i.v.)
g. Mouse Response
  • Persistence: An actA mutant is attenuated in mice (Darji et al., 2003).
  • Efficacy: An actA mutant induces significant protection in mice from challenge with wild type L. monocytogenes (Darji et al., 2003).
4. Listeria monocytogenes actA/plcB mutant vaccine
a. Type:
Live, attenuated vaccine
b. Status:
Research
c. Host Species as Laboratory Animal Model:
Mouse
d. Gene Engineering of actA
  • Type: Gene mutation
  • Description: This actA/plcB mutant is from Listeria monocytogenes (Darji et al., 2003).
  • Detailed Gene Information: Click here.
e. Gene Engineering of plcB
  • Type: Gene mutation
  • Description: This actA/plcB mutant is from Listeria monocytogenes (Darji et al., 2003).
  • Detailed Gene Information: Click here.
f. Immunization Route
Intravenous injection (i.v.)
g. Mouse Response
  • Persistence: An actA/plcB mutant is attenuated in mice (Darji et al., 2003).
  • Efficacy: An actA/plcB mutant induces significant protection in mice from challenge with wild type L. monocytogenes (Darji et al., 2003).
  • Host Gene Response of Ifng (Interferon gamma)
    • Gene Response: The ΔactAΔplcB mutant is able to induce sufficient IFN-γ in mice to prevent a Th1 to Th2 switch and retains its ability to induce a strong CD8+-mediated T cell response, even though the amount of IFN-gamma produced is less than that produced after infection with the wild type strain (Darji et al., 2003).
    • Detailed Gene Information: Click here.
V. References
1. Brockstedt et al., 2005: Brockstedt DG, Bahjat KS, Giedlin MA, Liu W, Leong M, Luckett W, Gao Y, Schnupf P, Kapadia D, Castro G, Lim JY, Sampson-Johannes A, Herskovits AA, Stassinopoulos A, Bouwer HG, Hearst JE, Portnoy DA, Cook DN, Dubensky TW Jr. Killed but metabolically active microbes: a new vaccine paradigm for eliciting effector T-cell responses and protective immunity. Nature medicine. 2005; 11(8); 853-860. [PubMed: 16041382].
2. Cornell et al., 1999: Cornell KA, Bouwer HG, Hinrichs DJ, Barry RA. Genetic immunization of mice against Listeria monocytogenes using plasmid DNA encoding listeriolysin O. Journal of immunology (Baltimore, Md. : 1950). 1999; 163(1); 322-329. [PubMed: 10384131].
3. Darji et al., 2003: Darji A, Mohamed W, Domann E, Chakraborty T. Induction of immune responses by attenuated isogenic mutant strains of Listeria monocytogenes. Vaccine. 2003; 21 Suppl 2; S102-109. [PubMed: 12763691].
4. Grenningloh et al., 2008: Grenningloh R, Darj A, Bauer H, zur Lage S, Chakraborty T, Jacobs T, Weiss S. Liposome-encapsulated antigens induce a protective CTL response against Listeria monocytogenes independent of CD4+ T cell help. Scandinavian journal of immunology. 2008; 67(6); 594-602. [PubMed: 18433404].
5. Jiang et al., 2007: Jiang S, Rasmussen RA, Nolan KM, Frankel FR, Lieberman J, McClure HM, Williams KM, Babu US, Raybourne RB, Strobert E, Ruprecht RM. Live attenuated Listeria monocytogenes expressing HIV Gag: immunogenicity in rhesus monkeys. Vaccine. 2007; 25(42); 7470-7479. [PubMed: 17854955].
6. Ramaswamy et al., 2007: Ramaswamy V, Cresence VM, Rejitha JS, Lekshmi MU, Dharsana KS, Prasad SP, Vijila HM. Listeria--review of epidemiology and pathogenesis. Journal of microbiology, immunology, and infection = Wei mian yu gan ran za zhi. 2007; 40(1); 4-13. [PubMed: 17332901].
7. Wiki: L. monocytogenes: Wiki: Listeria monocytogenes [http://en.wikipedia.org/wiki/Listeria_monocytogenes]