VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Avian Reovirus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. sigma C protein (Protective antigen)
  3. Vaccine Information
    1. Avian Reovirus Killed Virus Vaccine (USDA: 1045.00)
    2. Avian Reovirus Killed Virus Vaccine (USDA: 1045.01)
    3. Avian Reovirus Killed Virus Vaccine (USDA: 1045.02)
    4. Avian Reovirus Killed Virus Vaccine (USDA: 1045.30)
    5. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.00)
    6. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.01)
    7. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Killed Virus Vaccine (USDA: 12M5.40)
    8. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.11)
    9. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.43)
    10. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.50)
    11. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.90)
    12. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.91)
    13. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.41)
    14. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.42)
    15. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.E0)
    16. Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.40)
    17. Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.41)
    18. Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.E0)
    19. Bursal Disease-Reovirus Killed Virus Vaccine (USDA: 12D5.02)
    20. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.01)
    21. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.03)
    22. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.04)
    23. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.30)
    24. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.E0)
    25. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.F0)
    26. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.F1)
    27. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.T0)
    28. Marek's Disease-Tenosynovitis Serotypes 2 & 3, Live & Modified Live Virus Vaccine (USDA: 16T1.00)
    29. Marek's Disease-Tenosynovitis Serotypes 2 & 3, Live Virus Vaccine (USDA: 16T1.03)
    30. Tenosynovitis Live Virus Vaccine (USDA: 1951.10)
    31. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.01)
    32. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.02)
    33. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.03)
    34. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.04)
    35. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.11)
    36. Tenosynovitis Modified Live Virus Vaccine (USDA: 1952.01)
  4. References
I. General Information
1. NCBI Taxonomy ID:
38170
2. Disease:
Viral Arthritis, Pale Bird Syndrome, Tenosynovitis
3. Introduction
Avian reoviruses, in the past, have been associated with viral arthritis/tenosynovitis, malabsorption syndrome, stunting/runting syndromes, enteric disease, immunosuppression, and respiratory disease. Recently, there have been reports from the field and isolations of reoviruses from chickens exhibiting neurological signs. In birds with the disease, varying degrees of lameness is a typical sign of the disease. Some birds may also be stunted in size. Avian reoviruses are widespread in nature and are known to cause viral arthritis and malabsortion / pale bird syndrome. However, recent field reports have associated the virus with neurological signs. Vaccination of breeder birds as well as strict biosecurity procedures can effectively reduce the effects of reoviruses on commercial poultry flocks (Avian Reovirus Infections).
1. sigma C protein
  • Gene Name : sigma C protein
  • Sequence Strain (Species/Organism) : Avian Reovirus
  • NCBI Protein GI : AAL83498
  • Other Database IDs : CDD:113356
    CDD:282382
    CDD:305065
    CDD:176481
  • Taxonomy ID : 177351
  • Protein Name : sigma C protein
  • Protein pI : 4.56
  • Protein Weight : 32765.55
  • Protein Length : 387
  • Protein Note : Reovirus sigma C capsid protein; pfam04582
  • Protein Sequence : Show Sequence
    >AAL83498.1 sigma C protein [Avian reovirus GEL13b98M]
    MEGLTPLQRREVVGLILSLTSSVSISSGDLIPLYERLSAIEKMCTTVNDSLGHLTSSVSEISARIDDLAE
    TVRNTVTDLNNVQIRVTALQSSFDSLSSNVTTLSSSVSNQESQLATVSTSVNALSTNVSNLQSDVSSTAL
    TVTSLGQRVEALESGAGSALTFISPLKVDGKSVLLDMDPYFCSERANLTSYSASAQLLQFQWFVRSEGGS
    SDSIDMNVVAHCHGRRTDYLMSTHDSLTVTGNSVTLVFNMDYITTQGVDYARLVPCHGFQQATFPVDISF
    TKDDATHSYQVYGAFAGPRIFKVTFSPGETSATNVRFLTVRTGIDT
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Wu et al., 2005)
III. Vaccine Information
1. Avian Reovirus Killed Virus Vaccine (USDA: 1045.00)
a. Manufacturer:
Wyeth, Intervet Inc.
b. Vaccine Ontology ID:
VO_0001606
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
2. Avian Reovirus Killed Virus Vaccine (USDA: 1045.01)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0001607
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
3. Avian Reovirus Killed Virus Vaccine (USDA: 1045.02)
a. Manufacturer:
Lohmann Animal Health International, Biomune Company
b. Vaccine Ontology ID:
VO_0001608
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
4. Avian Reovirus Killed Virus Vaccine (USDA: 1045.30)
a. Manufacturer:
Biomune Company
b. Vaccine Ontology ID:
VO_0001609
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
5. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.00)
a. Manufacturer:
Lohmann Animal Health International, Biomune Company
b. Vaccine Ontology ID:
VO_0002075
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
6. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.01)
a. Manufacturer:
Intervet Inc., Lohmann Animal Health International, Biomune Company
b. Vaccine Ontology ID:
VO_0002076
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
7. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Killed Virus Vaccine (USDA: 12M5.40)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002078
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
8. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.11)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002077
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
9. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.43)
a. Manufacturer:
Lohmann Animal Health International
b. Vaccine Ontology ID:
VO_0002081
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
10. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.50)
a. Manufacturer:
Biomune Company
b. Vaccine Ontology ID:
VO_0002082
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
11. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.90)
a. Manufacturer:
Wyeth, Lohmann Animal Health International
b. Vaccine Ontology ID:
VO_0002083
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
12. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.91)
a. Manufacturer:
Wyeth, Lohmann Animal Health International
b. Vaccine Ontology ID:
VO_0002084
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
13. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.41)
a. Manufacturer:
Lohmann Animal Health International, Merial, Inc.
b. Vaccine Ontology ID:
VO_0002079
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
14. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.42)
a. Manufacturer:
Lohmann Animal Health International
b. Vaccine Ontology ID:
VO_0002080
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
15. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.E0)
a. Manufacturer:
Biomune Company
b. Vaccine Ontology ID:
VO_0002085
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
16. Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.40)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0002086
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
17. Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.41)
a. Manufacturer:
Intervet Inc., Biomune Company
b. Vaccine Ontology ID:
VO_0002087
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
18. Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.E0)
a. Manufacturer:
Biomune Company
b. Vaccine Ontology ID:
VO_0002088
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
19. Bursal Disease-Reovirus Killed Virus Vaccine (USDA: 12D5.02)
a. Manufacturer:
Biomune Company
b. Vaccine Ontology ID:
VO_0002056
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
20. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.01)
a. Manufacturer:
Merial, Inc., Biomune Company
b. Vaccine Ontology ID:
VO_0002055
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
21. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.03)
a. Manufacturer:
Lohmann Animal Health International
b. Vaccine Ontology ID:
VO_0002057
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
22. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.04)
a. Manufacturer:
Lohmann Animal Health International
b. Vaccine Ontology ID:
VO_0002058
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
23. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.30)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002059
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
24. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.E0)
a. Manufacturer:
Biomune Company
b. Vaccine Ontology ID:
VO_0002061
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
25. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.F0)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002062
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
26. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.F1)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002063
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
27. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.T0)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002064
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
28. Marek's Disease-Tenosynovitis Serotypes 2 & 3, Live & Modified Live Virus Vaccine (USDA: 16T1.00)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0002146
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
29. Marek's Disease-Tenosynovitis Serotypes 2 & 3, Live Virus Vaccine (USDA: 16T1.03)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002147
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
30. Tenosynovitis Live Virus Vaccine (USDA: 1951.10)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001730
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
31. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.01)
a. Manufacturer:
Wyeth, Lohmann Animal Health International
b. Vaccine Ontology ID:
VO_0001731
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
32. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.02)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001732
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
33. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.03)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0001733
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
34. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.04)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001734
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
35. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.11)
a. Manufacturer:
Wyeth, Intervet Inc.
b. Vaccine Ontology ID:
VO_0001735
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
36. Tenosynovitis Modified Live Virus Vaccine (USDA: 1952.01)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0001736
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
IV. References
1. Avian Reovirus Infections: Avian Reovirus Infections [http://www.thepoultrysite.com/articles/96/avian-reovirus-infections]
2. Wu et al., 2005: Wu H, Williams Y, Gunn KS, Singh NK, Locy RD, Giambrone JJ. Yeast-derived sigma C protein-induced immunity against avian reovirus. Avian diseases. 2005; 49(2); 281-284. [PubMed: 16094835].