Feline herpesvirus 1 |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Microbial Pathogenesis
- Host Ranges and Animal Models
- Host Protective Immunity
- Vaccine Related Pathogen Genes
- env
(Protective antigen)
- gD protein
(Protective antigen)
- UL23
(Virmugen)
- Vaccine Information
- Feline herpesvirus 1 UL23 mutant vaccine
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.20)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.21)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.20)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.21)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.20)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.23)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.2C)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1559.2B)
- Feline Rhinotracheitis Modified Live Virus Vaccine (USDA: 16A1.22)
- Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.20)
- Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.21)
- Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.20)
- Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.23)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 16D9.20)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.20)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.22)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.23)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.24)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.20)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.21)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.23)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Killed Chlamydia Vaccine (USDA: 16E6.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.24)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E8.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1619.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live Virus and Chlamydia, Canarypox Vector Vaccine (USDA: 1619.R1)
- Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live & Killed Virus Vaccine (USDA: 16T9.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live Virus, Canarypox Vector Vaccine (USDA: 16T9.R0)
- Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.20)
- Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.21)
- Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.22)
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
10334 |
2. Disease: |
Feline viral rhinotracheitis |
3. Introduction |
Feline herpesvirus (FHV-1; felid herpesvirus 1 (FeHV-1)) is an alphaherpesvirus of cats closely related to canine herpesvirus-1 and phocine herpesvirus-1. Like other herpesviruses, FeHV-1 contains double-stranded DNA and has a glycoprotein-lipid envelope. It is therefore relatively fragile in the external environment and is highly susceptible to the effects of common disinfectants. There is only one serotype of the virus and it is relatively homogenous genetically. FeHV-1 is an important cause of acute upper respiratory tract and ocular disease in cats. In addition, its role in more chronic ocular disease and skin lesions is increasingly being recognised. Epidemiologically, FeHV-1 behaves as a typical alphaherpesvirus whereby clinically recovered cats become latently infected carriers which undergo periodic episodes of virus reactivation, particularly after a stress. The primary site of latency is the trigeminal ganglion. Conventional inactivated and modified-live vaccines are available and protect reasonably well against disease but not infection, although viral shedding may be reduced. FeHV-1 is shed in ocular, nasal, and oral secretions and transmission is largely by direct contact with an infected cat. Acutely infected animals are clearly one of the most important sources of virus, but latently infected carrier cats may also shed virus and infect susceptible cats (Gaskell et al., 2007). |
4. Microbial Pathogenesis |
The natural routes of infection for FeHV-1 are via the nasal, oral, and conjunctival mucous membranes, though experimentally other routes have been investigated. Following infection, virus replication in the acute phase takes place predominantly in the mucosae of the nasal septum, turbinates, nasopharynx, and tonsils; other tissues including conjunctivae, mandibular lymph nodes and upper trachea are also often involved (Gaskell et al., 2007). |
5. Host Ranges and Animal Models |
As well as domestic cats, FeHV-1 infects several other members of the Felidae (Gaskell et al., 2007). |
6. Host Protective Immunity |
Immunity to FeHV-1 has generally been measured by serum virus neutralizing (VN) antibody levels, although as for other alphaherpesviruses, cell-mediated immunity is likely to be a better reflection of immune status (Gaskell et al., 2007). |
II. Vaccine Related Pathogen Genes |
1. env |
-
Gene Name :
env
-
Sequence Strain (Species/Organism) :
Feline herpesvirus 1
-
NCBI Protein GI :
BAA12690
-
Other Database IDs :
CDD:150302
-
Taxonomy ID :
11673
-
Protein Name :
env, partial [Feline immunodeficiency virus]
-
Protein pI :
9.01
-
Protein Weight :
27451.51
-
Protein Length :
303
-
Protein Note :
Lentivirus surface glycoprotein; pfam09590
-
Protein Sequence : Show Sequence
>BAA12690.1 env, partial [Feline immunodeficiency virus]
IPKCGWWNQAAYYNSYKWEPTNVTFQCQRTQSQPGTWSRTISSWRQRNRWEWRPDFESEKVKISLQCNST
KNLTFAMRSTSDYYDITGAWIEFGCYRNKSRFYNPARFRIRCKWNEGNNISLIDTCGTNHNVTGANPVDC
TMKASTMYNCSLQNGFTMKIEDLIVHFNMTKAVEMYNIAGNWSCRSDLPTGWGYMMCNCTNGDNNVNKMT
CPENQGILRNWYNPVAGLRQALMKYQVVKQP
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Sato et al., 2000)
|
2. gD protein |
-
Gene Name :
gD protein
-
Sequence Strain (Species/Organism) :
Feline herpesvirus 1
-
NCBI Protein GI :
AHZ31390
-
Other Database IDs :
CDD:223029
CDD:279830 CDD:288690
-
Taxonomy ID :
10334
-
Protein Name :
gD protein
-
Protein pI :
8.43
-
Protein Weight :
41597.82
-
Protein Length :
431
-
Protein Note :
envelope glycoprotein D; Provisional
-
Protein Sequence : Show Sequence
>AHZ31390.1 gD protein [Felid alphaherpesvirus 1]
MMTRLHFWWCGIFAVLKYLVCTSSLTTTPKTTTVYVKGFNISPLRYNYTQARIVPKIPQAMDPKITAEVR
YVTSMDSCGMVALISEPDIDATIRTIQLSQKKTYNATISWFKVTQGCEYPMFLMDMRLCDPKREFGICAL
RSPSYWLEPLTKYMFLTDDELGLIMMAPAQFNQGQYRRVITIDGSMFYTDFMVQLSPTPCWFAKPDRYEE
ILHEWCRNVKTIGLDGARDYHYYWVPYNPQPHHKAVLLYWYRTHGREPPVRFQEAIRYDRPAIPSGSEDS
KRSNDSRGESSGPNWIDIENYTPKNNVPIIISDDDVPTAPPKGMNNQSVVIPAIVLSCLIIALILGVIYY
ILRVKRSRSTAYQQLPIIHTTHHP
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Maeda et al., 1996)
|
3. UL23 |
-
Gene Name :
UL23
-
Sequence Strain (Species/Organism) :
Felid herpesvirus 1
-
NCBI Gene ID :
8658565
-
NCBI Protein GI :
270339476
-
Locus Tag :
FeHV-1_gp39
-
Genbank Accession :
M26660
-
Protein Accession :
YP_003331558
-
Taxonomy ID :
10334
-
Gene Starting Position :
66386
-
Gene Ending Position :
67418
-
Gene Strand (Orientation) :
+
-
Protein Name :
thymidine kinase
-
Protein pI :
6.44
-
Protein Weight :
36838.45
-
Protein Length :
343
-
Protein Note :
Also known as TK
-
DNA Sequence : Show Sequence
>gi|281190771:66386-67418 Felid herpesvirus 1, complete genome
GATGGCGAGTGGAACCATCCCCGTTCAGAATGAAGAGATTATTAAATCACAGGTGAATACTGTCCGCATT
TACATAGATGGTGCCTATGGAATAGGTAAGAGTTTAACGGCGAAGTACCTGGTCAGAGCGGATGAAAATC
GACCGGGATATACTTACTACTTCCCAGAACCAATGCTATACTGGCGTAGTCTCTTTGAAACTGATGTTGT
CGGTGGTATCTATGCCGTCCAGGACCGGAAACGACGTGGTGAATTATCAGCTGAAGATGCTGCCTATATC
ACCGCCCACTATCAAGCAAGATTTGCCGCACCATACCTTCTTTTACATTCCAGACTATCCACAATAACAG
GATATCAGAAAGTTGTATGTGAGGAACACCCCGACGTGACCCTAATCATAGATAGACACCCTCTCGCCTC
TCTGGTCTGTTTCCCACTCGCAAGATATTTTGTGGGTGATATGACTCTTGGGTCTGTACTTAGTCTAATG
GCAACACTTCCACGAGAACCTCCTGGTGGAAATCTAGTTGTAACAACCTTGAATATCGAGGAACATTTGA
AGCGTCTCAGGGGACGCTCAAGAACCGGAGAACAGATAGACATGAAGCTAATTCACGCACTACGCAATGT
ATATATGATGTTGGTACATACTAAGAAATTTTTAACAAAAAATACTAGTTGGCGTGATGGGTGGGGGAAG
CTTAAAATTTTCTCCCACTATGAACGGAATAGGCTCGTGGAAACTACAATAGTTTCCGATTCGACGGAGT
CAGATTTATGTGACACATTATTCAGTGTTTTCAAAGCCCGGGAGCTCTCCGACCAAAATGGAGATCTACT
TGACATGCATGCATGGGTCCTCGATGGACTTATGGAAACCCTCCAAAATTTACAGATCTTTACTTTAAAT
CTGGAAGGAACCCCTGATGAATGTGCCGCCGCCTTGGGAGCACTGAGACAAGATATGGATATGACATTTA
TAGCCGCATGTGATATGCACCGTATAAGTGAAGCCTTGACGATATACCATTAA
-
Protein Sequence : Show Sequence
>gi|270339476|ref|YP_003331558.1| thymidine kinase [Felid herpesvirus 1]
MASGTIPVQNEEIIKSQVNTVRIYIDGAYGIGKSLTAKYLVRADENRPGYTYYFPEPMLYWRSLFETDVV
GGIYAVQDRKRRGELSAEDAAYITAHYQARFAAPYLLLHSRLSTITGYQKVVCEEHPDVTLIIDRHPLAS
LVCFPLARYFVGDMTLGSVLSLMATLPREPPGGNLVVTTLNIEEHLKRLRGRSRTGEQIDMKLIHALRNV
YMMLVHTKKFLTKNTSWRDGWGKLKIFSHYERNRLVETTIVSDSTESDLCDTLFSVFKARELSDQNGDLL
DMHAWVLDGLMETLQNLQIFTLNLEGTPDECAAALGALRQDMDMTFIAACDMHRISEALTIYH
-
Molecule Role :
Virmugen
-
Molecule Role Annotation :
A thymidine kinase-deficient mutant (C7301dlTK) is attenuated in cats and induced significant protection from wild type FHV-1 4 weeks after vaccination (Yokoyama et al., 1996).
- Related Vaccine(s):
Feline herpesvirus 1 UL23 mutant vaccine
|
III. Vaccine Information |
 |
|
 |
|
|
|
1. Feline herpesvirus 1 UL23 mutant vaccine |
a. Product Name: |
C7301dlTK |
b. Vaccine Ontology ID: |
VO_0002958 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Research |
e. Host Species as Laboratory Animal Model: |
Cat |
f. Gene Engineering of
UL23 |
|
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Cat Response |
|
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
2. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001843 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
3. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001844 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
4. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001845 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
5. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001846 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
6. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001847 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
7. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001848 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
8. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.2C) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001849 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
9. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1559.2B) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001850 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
10. Feline Rhinotracheitis Modified Live Virus Vaccine (USDA: 16A1.22) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001555 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
11. Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001851 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
12. Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.21) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001852 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
13. Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001853 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
14. Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001854 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
15. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 16D9.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001855 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
16. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.20) |
a. Manufacturer: |
Wyeth, Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001856 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
17. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.22) |
a. Manufacturer: |
Wyeth, Intervet Inc., Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001857 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
18. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.23) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001858 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
19. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.24) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001859 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
20. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001860 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
21. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.21) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001861 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
22. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001862 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
23. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001863 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
24. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Killed Chlamydia Vaccine (USDA: 16E6.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001864 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
25. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.20) |
a. Manufacturer: |
Wyeth, Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001865 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
26. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.24) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001866 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
27. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E8.20) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001867 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
28. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1619.20) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001868 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
29. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live Virus and Chlamydia, Canarypox Vector Vaccine (USDA: 1619.R1) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001869 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
30. Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live & Killed Virus Vaccine (USDA: 16T9.20) |
a. Manufacturer: |
Intervet Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001870 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
31. Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live Virus, Canarypox Vector Vaccine (USDA: 16T9.R0) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001871 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
32. Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Pfizer, Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001872 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
33. Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.21) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001873 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
34. Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.22) |
a. Manufacturer: |
Wyeth, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001874 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
IV. References |
1. Gaskell et al., 2007: Gaskell R, Dawson S, Radford A, Thiry E. Feline herpesvirus. Veterinary research. 2007; 38(2); 337-354. [PubMed: 17296160].
2. Maeda et al., 1996: Maeda K, Ono M, Kawaguchi Y, Niikura M, Okazaki K, Yokoyama N, Tokiyoshi Y, Tohya Y, Mikami T. Expression and properties of feline herpesvirus type 1 gD (hemagglutinin) by a recombinant baculovirus. Virus research. 1996; 46(1-2); 75-80. [PubMed: 9029779].
3. Sato et al., 2000: Sato E, Yokoyama N, Miyazawa T, Maeda K, Ikeda Y, Nishimura Y, Fujita K, Kohmoto M, Takahashi E, Mikami T. Efficient expression of the envelope protein of feline immunodeficiency virus in a recombinant feline herpesvirus type 1 (FHV-1) using the gC promoter of FHV-1. Virus research. 2000; 70(1-2); 13-23. [PubMed: 11074121].
4. Yokoyama et al., 1996: Yokoyama N, Maeda K, Tohya Y, Kawaguchi Y, Shin YS, Ono M, Ishiguro S, Fujikawa Y, Mikami T. Pathogenicity and vaccine efficacy of a thymidine kinase-deficient mutant of feline herpesvirus type 1 in cats. Archives of virology. 1996; 141(3-4); 481-494. [PubMed: 8645090].
|