VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Feline herpesvirus 1

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. UL23 (Virmugen)
  3. Vaccine Information
    1. Feline herpesvirus 1 UL23 mutant vaccine
    2. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.20)
    3. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.21)
    4. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.20)
    5. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.21)
    6. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.20)
    7. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.23)
    8. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.2C)
    9. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1559.2B)
    10. Feline Rhinotracheitis Modified Live Virus Vaccine (USDA: 16A1.22)
    11. Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.20)
    12. Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.21)
    13. Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.20)
    14. Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.23)
    15. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 16D9.20)
    16. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.20)
    17. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.22)
    18. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.23)
    19. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.24)
    20. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.20)
    21. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.21)
    22. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.20)
    23. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.23)
    24. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Killed Chlamydia Vaccine (USDA: 16E6.20)
    25. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.20)
    26. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.24)
    27. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E8.20)
    28. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1619.20)
    29. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live Virus and Chlamydia, Canarypox Vector Vaccine (USDA: 1619.R1)
    30. Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live & Killed Virus Vaccine (USDA: 16T9.20)
    31. Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live Virus, Canarypox Vector Vaccine (USDA: 16T9.R0)
    32. Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.20)
    33. Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.21)
    34. Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.22)
  4. References
I. General Information
1. NCBI Taxonomy ID:
10334
2. Disease:
Feline viral rhinotracheitis
3. Introduction
Feline herpesvirus (FHV-1; felid herpesvirus 1 (FeHV-1)) is an alphaherpesvirus of cats closely related to canine herpesvirus-1 and phocine herpesvirus-1. Like other herpesviruses, FeHV-1 contains double-stranded DNA and has a glycoprotein-lipid envelope. It is therefore relatively fragile in the external environment and is highly susceptible to the effects of common disinfectants. There is only one serotype of the virus and it is relatively homogenous genetically. FeHV-1 is an important cause of acute upper respiratory tract and ocular disease in cats. In addition, its role in more chronic ocular disease and skin lesions is increasingly being recognised. Epidemiologically, FeHV-1 behaves as a typical alphaherpesvirus whereby clinically recovered cats become latently infected carriers which undergo periodic episodes of virus reactivation, particularly after a stress. The primary site of latency is the trigeminal ganglion. Conventional inactivated and modified-live vaccines are available and protect reasonably well against disease but not infection, although viral shedding may be reduced. FeHV-1 is shed in ocular, nasal, and oral secretions and transmission is largely by direct contact with an infected cat. Acutely infected animals are clearly one of the most
important sources of virus, but latently infected carrier cats may also shed virus and infect susceptible cats (Gaskell et al., 2007).
4. Microbial Pathogenesis
The natural routes of infection for FeHV-1 are via the nasal, oral, and conjunctival mucous membranes, though experimentally other routes have been investigated. Following infection, virus replication in the acute phase takes place predominantly in the mucosae of the nasal septum, turbinates, nasopharynx, and tonsils; other tissues including conjunctivae, mandibular lymph nodes and upper trachea are also often involved (Gaskell et al., 2007).
5. Host Ranges and Animal Models
As well as domestic cats, FeHV-1 infects several other members of the Felidae (Gaskell et al., 2007).
6. Host Protective Immunity
Immunity to FeHV-1 has generally been measured by serum virus neutralizing (VN) antibody levels, although as for other alphaherpesviruses, cell-mediated immunity is likely to be a better reflection of immune status (Gaskell et al., 2007).
1. UL23
  • Gene Name : UL23
  • Sequence Strain (Species/Organism) : Felid herpesvirus 1
  • NCBI Gene ID : 8658565
  • NCBI Protein GI : 270339476
  • Locus Tag : FeHV-1_gp39
  • Genbank Accession : M26660
  • Protein Accession : YP_003331558
  • Taxonomy ID : 10334
  • Gene Starting Position : 66386
  • Gene Ending Position : 67418
  • Gene Strand (Orientation) : +
  • Protein Name : thymidine kinase
  • Protein pI : 6.44
  • Protein Weight : 36838.45
  • Protein Length : 343
  • Protein Note : Also known as TK
  • DNA Sequence : Show Sequence
    >gi|281190771:66386-67418 Felid herpesvirus 1, complete genome
    GATGGCGAGTGGAACCATCCCCGTTCAGAATGAAGAGATTATTAAATCACAGGTGAATACTGTCCGCATT
    TACATAGATGGTGCCTATGGAATAGGTAAGAGTTTAACGGCGAAGTACCTGGTCAGAGCGGATGAAAATC
    GACCGGGATATACTTACTACTTCCCAGAACCAATGCTATACTGGCGTAGTCTCTTTGAAACTGATGTTGT
    CGGTGGTATCTATGCCGTCCAGGACCGGAAACGACGTGGTGAATTATCAGCTGAAGATGCTGCCTATATC
    ACCGCCCACTATCAAGCAAGATTTGCCGCACCATACCTTCTTTTACATTCCAGACTATCCACAATAACAG
    GATATCAGAAAGTTGTATGTGAGGAACACCCCGACGTGACCCTAATCATAGATAGACACCCTCTCGCCTC
    TCTGGTCTGTTTCCCACTCGCAAGATATTTTGTGGGTGATATGACTCTTGGGTCTGTACTTAGTCTAATG
    GCAACACTTCCACGAGAACCTCCTGGTGGAAATCTAGTTGTAACAACCTTGAATATCGAGGAACATTTGA
    AGCGTCTCAGGGGACGCTCAAGAACCGGAGAACAGATAGACATGAAGCTAATTCACGCACTACGCAATGT
    ATATATGATGTTGGTACATACTAAGAAATTTTTAACAAAAAATACTAGTTGGCGTGATGGGTGGGGGAAG
    CTTAAAATTTTCTCCCACTATGAACGGAATAGGCTCGTGGAAACTACAATAGTTTCCGATTCGACGGAGT
    CAGATTTATGTGACACATTATTCAGTGTTTTCAAAGCCCGGGAGCTCTCCGACCAAAATGGAGATCTACT
    TGACATGCATGCATGGGTCCTCGATGGACTTATGGAAACCCTCCAAAATTTACAGATCTTTACTTTAAAT
    CTGGAAGGAACCCCTGATGAATGTGCCGCCGCCTTGGGAGCACTGAGACAAGATATGGATATGACATTTA
    TAGCCGCATGTGATATGCACCGTATAAGTGAAGCCTTGACGATATACCATTAA
  • Protein Sequence : Show Sequence
    >gi|270339476|ref|YP_003331558.1| thymidine kinase [Felid herpesvirus 1]
    MASGTIPVQNEEIIKSQVNTVRIYIDGAYGIGKSLTAKYLVRADENRPGYTYYFPEPMLYWRSLFETDVV
    GGIYAVQDRKRRGELSAEDAAYITAHYQARFAAPYLLLHSRLSTITGYQKVVCEEHPDVTLIIDRHPLAS
    LVCFPLARYFVGDMTLGSVLSLMATLPREPPGGNLVVTTLNIEEHLKRLRGRSRTGEQIDMKLIHALRNV
    YMMLVHTKKFLTKNTSWRDGWGKLKIFSHYERNRLVETTIVSDSTESDLCDTLFSVFKARELSDQNGDLL
    DMHAWVLDGLMETLQNLQIFTLNLEGTPDECAAALGALRQDMDMTFIAACDMHRISEALTIYH
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A thymidine kinase-deficient mutant (C7301dlTK) is attenuated in cats and induced significant protection from wild type FHV-1 4 weeks after vaccination (Yokoyama et al., 1996).
  • Related Vaccine(s): Feline herpesvirus 1 UL23 mutant vaccine
III. Vaccine Information
1. Feline herpesvirus 1 UL23 mutant vaccine
a. Product Name:
C7301dlTK
b. Vaccine Ontology ID:
VO_0002958
c. Type:
Live, attenuated vaccine
d. Status:
Research
e. Host Species as Laboratory Animal Model:
Cat
f. Gene Engineering of UL23
g. Immunization Route
Intramuscular injection (i.m.)
h. Cat Response
  • Persistence: A UL23 mutant is attenuated in cats (Yokoyama et al., 1996).
  • Efficacy: A UL23 mutant induces significant protection in cats from wild type FHV-1 4 weeks after vaccination (Yokoyama et al., 1996).
2. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001843
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
3. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001844
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
4. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001845
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
5. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001846
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
6. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001847
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
7. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.23)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001848
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
8. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.2C)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001849
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
9. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1559.2B)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001850
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
10. Feline Rhinotracheitis Modified Live Virus Vaccine (USDA: 16A1.22)
a. Manufacturer:
Heska Corporation
b. Vaccine Ontology ID:
VO_0001555
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
11. Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.20)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001851
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
12. Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.21)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0001852
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
13. Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001853
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
14. Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.23)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001854
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
15. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 16D9.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001855
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
16. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.20)
a. Manufacturer:
Wyeth, Intervet Inc., Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001856
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
17. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.22)
a. Manufacturer:
Wyeth, Intervet Inc., Heska Corporation
b. Vaccine Ontology ID:
VO_0001857
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
18. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.23)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001858
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
19. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.24)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001859
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
20. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0001860
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
21. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.21)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0001861
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
22. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001862
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
23. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.23)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001863
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
24. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Killed Chlamydia Vaccine (USDA: 16E6.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001864
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
25. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.20)
a. Manufacturer:
Wyeth, Intervet Inc., Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001865
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
26. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.24)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001866
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
27. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E8.20)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0001867
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
28. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1619.20)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0001868
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
29. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live Virus and Chlamydia, Canarypox Vector Vaccine (USDA: 1619.R1)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0001869
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
30. Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live & Killed Virus Vaccine (USDA: 16T9.20)
a. Manufacturer:
Intervet Inc., Merial, Inc.
b. Vaccine Ontology ID:
VO_0001870
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
31. Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live Virus, Canarypox Vector Vaccine (USDA: 16T9.R0)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0001871
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
32. Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Pfizer, Inc., Merial, Inc.
b. Vaccine Ontology ID:
VO_0001872
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
33. Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.21)
a. Manufacturer:
Intervet Inc., Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001873
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
34. Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.22)
a. Manufacturer:
Wyeth, Heska Corporation
b. Vaccine Ontology ID:
VO_0001874
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
IV. References
1. Gaskell et al., 2007: Gaskell R, Dawson S, Radford A, Thiry E. Feline herpesvirus. Veterinary research. 2007; 38(2); 337-354. [PubMed: 17296160].
2. Yokoyama et al., 1996: Yokoyama N, Maeda K, Tohya Y, Kawaguchi Y, Shin YS, Ono M, Ishiguro S, Fujikawa Y, Mikami T. Pathogenicity and vaccine efficacy of a thymidine kinase-deficient mutant of feline herpesvirus type 1 in cats. Archives of virology. 1996; 141(3-4); 481-494. [PubMed: 8645090].