VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Gallid herpesvirus 1

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
    5. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. gB (Protective antigen)
    2. UL27 (Protective antigen)
    3. UL0 (Virmugen)
    4. UL23 (Virmugen)
    5. UL47 (Virmugen)
  3. Vaccine Information
    1. Avian Encephalomyelitis-Fowl Pox-Laryngotracheitis Live Virus, Live Fowl Pox Vector Vaccine (USDA: 10S1.R0)
    2. Fowl Laryngotracheitis Modified Live Virus Vaccine (USDA: 1601.01)
    3. Fowl Laryngotracheitis Modified Live Virus Vaccine (USDA: 1601.02)
    4. Fowl Laryngotracheitis Modified Live Virus Vaccine (USDA: 1601.11)
    5. Fowl Laryngotracheitis Modified Live Virus Vaccine (USDA: 1601.13)
    6. Fowl Laryngotracheitis Modified Live Virus Vaccine (USDA: 1601.14)
    7. Fowl Laryngotracheitis Modified Live Virus Vaccine (USDA: 1601.15)
    8. Fowl Laryngotracheitis-Marek's Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 16J1.R1)
    9. Fowl Laryngotracheitis-Marek's Disease Serotypes 2 & 3, Modified Live & Live Marek's Disease Vector Vaccine (USDA: 16J1.R2)
    10. Fowl Pox-Laryngotracheitis Live Fowl Pox Vector Vaccine (USDA: 1F31.R0)
    11. Gallid herpesvirus 1 UL0 mutant vaccine
    12. Gallid herpesvirus 1 UL23 mutant vaccine
    13. Gallid herpesvirus 1 UL47 mutant vaccine
    14. Laryngotracheitis DNA Vaccine encoding gB
  4. References
I. General Information
1. NCBI Taxonomy ID:
10386
2. Disease:
Avian infectious laryngotracheitis, Fowl Laryngotracheitis
3. Introduction
Infectious laryngotracheitis (ILT) is a worldwide occurring respiratory disease of chickens, which is caused by a virus designated as ILTV or gallid herpesvirus 1 (GaHV-1). Infectious laryngotracheitis virus (ILTV) is an alphaherpesvirus that causes an economically important chicken disease, which results in delayed growth, reduced egg production, and also frequently in death of the animals. After acute infection of the upper respiratory tract, the virus can establish latency in the central nervous system, and subsequent reactivations can lead to infection of naive chickens. For prevention of ILT, conventionally attenuated live vaccines are available. The severity of clinical symptoms depends on the virulence of a particular strain or isolate, and mortality rates can vary between 0 and more than 70%. Symptoms of milder forms of ILT are nasal discharge, conjunctivitis and reduced egg production, whereas severe forms are additionally characterized by gasping, coughing, expectoration of bloody mucus, and marked dyspnoea which may lead to suffocation. Pathomorphological alterations can be observed in conjunctiva, larynx, trachea, and sometimes also in the lungs and air sacs (Fuchs et al., 2007).
4. Host Ranges and Animal Models
Like other avian herpesviruses, ILTV exhibits a very narrow host range both in vivo and in vitro. Besides domestic chickens, pheasants represent the only natural hosts. Furthermore, the virus could be isolated from peafowl, and experimental infections of turkeys have also been described (Fuchs et al., 2007).
5. Host Protective Immunity
ILTV infection of chickens frequently induces production of virus-neutralizing antibodies, but antibody titers correlate only poorly with protective immunity (Fuchs et al., 2007).
1. gB
  • Gene Name : gB
  • Sequence Strain (Species/Organism) : Gallid herpesvirus 1 isolate CG
  • NCBI Protein GI : 110676569
  • Other Database IDs : CDD:177560
  • Taxonomy ID : 10386
  • Gene Strand (Orientation) : ?
  • Protein Name : glycoprotein B
  • Protein Length : 873
  • Protein Note : glycoprotein BALF4; Provisional
  • Protein Sequence : Show Sequence
    >gi|110676569|gb|ABG85153.1| glycoprotein B [Gallid herpesvirus 1]
    MASLKMLICVCVAILIPSTLSQDSHGIAGIIDPRDTASMDVGKISFPEAIGSGAPKEPQIRNRIFACSSP
    TGASVARLAQPRHCHRHADSTNMTEGIAVVFKQNIAPYVFNVTLYYKHITTVTTWALFSRPQITNEYVTR
    VPIDYHEIVRIDRSGECSSKATYHKNFMFFEAYDNDEAEKKLPLVPSLLRSTVSKAFHTTNFTKRHQTLG
    YRTSTSVDCVVEYLQARSVYPYDYFGMATGDTVEISPFYTKNTTGPRRHSVYRDYRFLEIANYQVRDLET
    GQIRPPKKRNFLTDEQFTIGWDAMEEKESVCTLSKWIEVPEAVRVSYKNSYHFSLKDMTMTFSSGKQPFN
    ISRLHLAECVPTIASEAIDGIFARKYSSTHVRSGDIEYYLGSGGFLIAFQKLMSHGLAEMHLEEAQRQNH
    LPRGRERRQAAGRRTASLQSGPQGDRITTHSSATFAMLQFAYDKIQAHVNELIGNLLEAWCELQNHQLIV
    WHEMKKLNPNSLMTSLFGQPVSARLLGDIVAVSKCIETPIENIRMQDSMRMPGDPTMCYTRPVLIFRYSS
    SPESQFSTNSTENHNLDILGQLGEHNEILQGRNLIEPCMINHRRYFLLGENYLLYEDYTFVRQVNASEIE
    EVSIFINLNATILEDLDFVPVEVYTREELRDTGTLNYDDVVRYQNIYNKRFRDIDTVIRGDRGDAIFRAI
    ADFFGNTLGEVGKALGTVVMTAAAAVISTVSGIASFLSNPFAALGIGIAVVVSIILGLLAFKYVMNLKSN
    PVQVLFPGAVPPAGTPPRPSRRYYKDEEEVEEDSDEDDRILATRVLKGLELLHKDEQKARRQKARFSAFA
    KNMRNLFRRKPRTKEDDYPLLEYPSWAEESEDE
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Laryngotracheitis DNA Vaccine encoding gB
2. UL0
  • Gene Name : UL0
  • Sequence Strain (Species/Organism) : Gallid herpesvirus 1
  • NCBI Gene ID : 3239037
  • NCBI Protein GI : 148828637
  • Locus Tag : GaHV1_gp60
  • Genbank Accession : X97256
  • Protein Accession : YP_182395
  • Taxonomy ID : 10386
  • Gene Starting Position : 106974
  • Gene Ending Position : 109923
  • Gene Strand (Orientation) : -
  • Protein Name : protein UL0
  • Protein pI : 6.59
  • Protein Weight : 53811.98
  • Protein Length : 506
  • Protein Note : UL0 family
  • DNA Sequence : Show Sequence
    >gi|57790931:106974-109923 Gallid herpesvirus 1, complete genome
    ATTTATTGTTTATCTCGCAATTTTACATATATTTTAACAGCAACAAGCTCCGCCCCAAAATAAACACCGG
    CGGAAAAAACATACTAATCTAAATTCCAGTCAATCGGTGACAGGCCCTTAGATTCGAAGTATTGATTTGC
    TTCCTCGAAATGGCGACAGTTGAACGGACGTCGCGTGCAGGTAGAAGGATGGATGAACTCCAACTTTAAA
    TGATTTTTAGGCACGCGGGGAATAAATCGTCTAGCTTCTTGGCCCCAAAGCATCAACACCGTAGATGACA
    ACTTTTCTAGTAGCGATGAGATCACTCCCTTTGTAAATTTGTCCCAGCCGATGGTTGAGTGCGATCTAGG
    AAAACCTTGTTCCACCGTCAAGTATTTGTTCAAAAGCAATACTCCCTTCCTGGCCCAAGATTCTAGACAC
    CCGTGAGTTTCCTTTGGAATAGATGGGTAACAGTCGCGTAGAGCTTCCAAAATGCGGCGCAAGCTGGGCG
    GTATACGGCACCCCCTAGGGACACTGAAAGCTAAGCCATGCGCGTGTCCTTCCGTGGGATACGGGTCTTG
    CCCAACGATAATAACACGCACATCTTGCGGATTGCAGTATCTTGTCCATGCAAAAATATCTCCTTTAGGA
    GGAAAGATTTTGCGGAATCTAGAACAGTAGGAGTACTGTAACAGCGTCTCACCGAAATCTTCATTTTCAA
    TTAGAGGTTTCAGAATTGACTCCCATGATGATGGTATTGAAAACTCTATGGCCACGTCGGTCCACTCCGG
    TACGAGCTTCCTCGCGGATGGTATAACCAATTGGACGGAAGTCATGCTCGGAGGGGGGAGAGTACGGCGT
    TTTTTAGCAGCGTTGGGGTCGGTATCTCTTTGGTTGCTTTCAGTAGGAGAGCTAATGTCCAGCGGACGCT
    TGAAGGGACTTTTTATGGGCTGCTCGCATAGTCCGGGTGATAGTGGTTGATGTTCGTTTCCGGCCATCTG
    AAATTTATGGTGGTCCTTTTATACAACGAATCAACAAGTCCACGAGCCAAGACGTTAGCAGCCGCAAGCC
    CGGTAGCTTCCAGCCGGTCTTGAAGAAGTCTAATCCCCAAGTACGGATTCACTTTTGCAGCGTACCCATT
    CTTATAGTAGAAAACAACTTCCGTGTTTACGCACAGAGGTCTGTAAATAATCACAGTCAAATTTTCAAAG
    TAGTCTCCCGATGGCAACGGCCCGAAAATTCGCGCACCGTTATCTCGCGAATTACTATCACATGGTGCGG
    CCGCGGCAGAAACAGGATCACGAAAAATGCCAGGTATATCGACACTTGAACATAGCATAAGAGATGCTAT
    TAGAAAAAAACAAGTCAACATTTTAAAAATCATTATCATATGGAGACCTAGGTCTCCGTTCACGATCCGT
    GTTACGTCGACGAGCAGATGGAACTCTTTGCGCCCGACTTCTAAATGGATCGTCGTCAGAATCTGAGTCG
    TCCGAATACAAATGTAGTGGTCTACAGGAACCAGTAGGTACTCTTTGTGGCGGACTTTTGAATGGATCGT
    CGTCCGAATCAGAGTCGTCCCAATATAAATATGACGGCCTAGATGGAGTACTTCGGCTCTGTAGTCCTGA
    AGGACCTTCACCTGCGTCATCGTTTCGCATGCGGAGGCTCCGATTCTGCATGGAATCGAGGTCTAAAATA
    CCTCTGTCTGCGGCGACGGGGGATTCGGGTTCATTCTTTATCCCCCCATGACGAGTCTGTGCACCAGTCG
    TATTTTGCCCTGCGCCATCATAATTAGACGAGGGGTGGTGGGGCGAAAGCTGTGGAGGGGAGCGTCTAGA
    TGGCGAGGGGAGGGATGATAACCTGAGGTCTAGGGCCGTAGGAGATGGCGCAGAAAATAAAGGGGGTATA
    GAGGACGGACGTGCGGGCGGTGGACTATGAGCGGGGCTATTTTCTATTTCATGCCGCACGACCCGTCGCA
    CCCACGACATCTCATATACATCTCGCACTTCTGCTCTACTCGCAAGGCCATAGTTGCCTTCCCCCTCTTC
    TGTCTCCGGTAACATAAACGTATCGGATACGGTGGTCGGCCGCTTTTTAACCATTGGATGTGCGAGCCCA
    ACTGGCTTGACGTCCGTGCTGTCATGAGACTCGCCTTTGACAGGAAGGCGGATCGACACCATCCCGGCGG
    AATTTTTAAAATATTTCAAATCCACCGTGAGTGGTCTGGTCAGCATGTCGGGCTGTATCGTCTCAGGAAT
    GGCCATTCCTACCCTGTACTCTAGACCCGATGCACTCTGTACCGTCGGGGTTTGTTCGTACGCCAAAAAG
    CTATCATATCCGCTAGGGTGATTCGTCGTAAACTCACGTATCCATCCATTGATCCTGGTTAGAAACGAGT
    AAAATACTTCAAGCATCTGTTCTTCATCCTGGAATGACAATTCCACTGCGCGTAGTGCGGAATTTGCTCC
    GCGCGTCACCAGATGACGCGCGTTTGAGATTTCTGGAGCTGAGGCGATTGCCATACTATAAACGACACTT
    TTAGCCCTCAGTAGAGTAGAATACAGCGCCTCAAAATTTCTCCACGTTAGTTGACGAGTTACAAACGTTT
    CAAGCATTATCGCCCTCAAAACGACTACAACGTCATCTATGGGGGATAGCCTTCCGGTATGGTGTCTTCG
    AGTTACTGGTCTTTCCTGTTCCAAAATAGTCTGGATGGCTTGGCGTTCTCCATCGGTAATAGGGGTACCG
    GCCTGCCGCCTGGTTTGAAGTAATCTCCTAACGCTTTCAACTGTTGTCGGAAAATAAGCTACAACAGAAA
    CCAAACCATTAATCCTCGTACCTCAAAAAATCTTACACGCGTCATCCCACCCCACAAACCACTTACGCCT
    CATCAAGACCCAGAAATCCATATAGTGCGCTTCATCGATGTCCGCCACGAATGCTATATTGAAATCTCCG
    TTCATTGTCA
  • Protein Sequence : Show Sequence
    >gi|148828637|ref|YP_182395.2| protein UL0 [Gallid herpesvirus 1]
    MTMNGDFNIAFVADIDEAHYMDFWVLMRPYFPTTVESVRRLLQTRRQAGTPITDGERQAIQTILEQERPV
    TRRHHTGRLSPIDDVVVVLRAIMLETFVTRQLTWRNFEALYSTLLRAKSVVYSMAIASAPEISNARHLVT
    RGANSALRAVELSFQDEEQMLEVFYSFLTRINGWIREFTTNHPSGYDSFLAYEQTPTVQSASGLEYRVGM
    AIPETIQPDMLTRPLTVDLKYFKNSAGMVSIRLPVKGESHDSTDVKPVGLAHPMVKKRPTTVSDTFMLPE
    TEEGEGNYGLASRAEVRDVYEMSWVRRVVRHEIENSPAHSPPPARPSSIPPLFSAPSPTALDLRLSSLPS
    PSRRSPPQLSPHHPSSNYDGAGQNTTGAQTRHGGIKNEPESPVAADRGILDLDSMQNRSLRMRNDDAGEG
    PSGLQSRSTPSRPSYLYWDDSDSDDDPFKSPPQRVPTGSCRPLHLYSDDSDSDDDPFRSRAQRVPSARRR
    NTDRERRPRSPYDNDF
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A UL0 mutant in infectious laryngotracheitis virus (ILTV) was attenuated. Chickens immunized with UL0-negative ILTV were protected from clinical disease after subsequent infection with virulent ILTV. (Veits et al., 2003).
  • Related Vaccine(s): Gallid herpesvirus 1 UL0 mutant vaccine
3. UL23
  • Gene Name : UL23
  • Sequence Strain (Species/Organism) : Gallid herpesvirus 1
  • NCBI Gene ID : 3239035
  • NCBI Protein GI : 57790948
  • Locus Tag : GaHV1_gp17
  • Genbank Accession : L36139
  • Protein Accession : YP_182352
  • Taxonomy ID : 10386
  • Gene Starting Position : 29808
  • Gene Ending Position : 34666
  • Gene Strand (Orientation) : -
  • Protein Name : thymidine kinase
  • Protein pI : 5.45
  • Protein Weight : 37832.47
  • Protein Length : 364
  • Protein Note : 2.7.1.21
  • DNA Sequence : Show Sequence
    >gi|57790931:29808-34666 Gallid herpesvirus 1, complete genome
    GTTTATTGATGTTTATGTTTCGGGTAATTATCCAAACAGATCAGGCCGCGTCGCAATTCCCATGTTCTTC
    CATGCTTCGGACACTGCTGTGCAAGCAGCCGTCTTAAAATCGCCTATCTCATCGGGGGTCCAATGAGAGT
    GCAATAAAATGCCGAGTCTAGGTGGATCGTACGCGTGGCAAATTGCTGCGCACAGAAACTTGCCGCACAT
    GGGAGTTTCTTCTAAAAGAGCGCGCCAGAAGGTAAAGCCTCGCCCAGTAAGCCAGCTAGTAGCTCTTGAT
    GCCCATGTATCTACCGCTAGATATGAGCGTTCGTCCGATGCCAATACCCCCGAAACTGGGAAAAACGCGC
    AAAGAATGTGAGTTCCTTTCGGAATCGAGGCTGTCTGCTGTGCGCGCGGTGGATGTATTTGGCTGTCGCC
    AATCGCAACACAAAACGGGATACGGAAAGCCCATTCTTCGCGGCAAGTAATTATCGGCGAAGCTATCTGT
    GATCGATACGCGCGTAACCCAGTAAATATCGCCGCTTGTAGTAGTCCGACGGGCGAGTGATGCGGGCTGT
    CTCCGTGCTTTAAATCAAGGATTTCTCCGCTTAGAGTAAGTGATGGAGGACTTTGAAAGAACAAGGCCCC
    GCTGAATGCGCGTACAGCAGCAACAACCGGAGAAAGTTCCAAATCCGAGATAAGTCCTAACATTAGAAAT
    CCGACTCCATCTTTCCACTTGTCTGCAGACAACAGTTTAAAAGGCAAATACTTGGCTCCAAAAGTCATCG
    GGTTTTTTGAATGCACGCTATCAGCTACGGCTTGCCATCTTTGGAAATTTTTTAAGGAAGCTCTTTTCAT
    GGCAAGAAGGAGCTGCTCGACGCCAATCTCTAAATTAGAATTAGTTGTGTAGGGAGTTCTAGTCATGATA
    ATTGCAGTAGAAGGAATTCCAGTGTCGTTGGAAAGGGATTCTTGCGGATCCTCAAATAATGGTGCTGCTA
    CGAATCGGATTTGAGAGTTATCGGGCTGTTTTGAGTCATGGTCTTGAAACACATGAATAGTCAAATCCTT
    GTTGCAATCCAGAAAAAACGATGCTGTGCCGTGCAGTACAGCTAGGCCATATTCTACCTTTTCTGTCCAT
    AGTTTTCCACGATGTGTTCCTAATTCCATGTGAGACGAGTCTACAAAGTTTGCGAGGCAGTGAGTTACTG
    CAAAACGACATTCGCGATTGCTGGTAGACAGTGCTTTGGAAGCCTGAGACTGCTTCTTTGACGGAGCCAT
    AGCCAGTTATTCGTGCTGCCGCAAGTGCAGTTGAAAAGGGTTTGTAAGGAACAAGGATTAAAGTTCGCTC
    TCCTCGTCAGACGGTAGCCGTACACGTCTAAATTGCGTTGCCGAGCTGAGGCAGAATTTATATATAGCCC
    TGATGGCACTCCATAGAGCAACCAATCCAACAAGTGCCCCTACCACAATACCGATAATGTATGCCTTGTC
    AAAAACTATTATGCTTCTGTCAAGTCCTAAAATTCGGACAGCAGTTCCGTGTGGTCCTAGAAGCGCGTAG
    TTATAGAACTCGGGGTTCATAGACTTAAAAAATGCAATAGATGAGTTGGCACCGGCTAACAGTTCTGATT
    GAACATATGCACTGTCTATAAAGAAAGCATCCTGGAACCCCCGTAGACCGTATTGAACTATCAGGTGGTT
    GCAATATATGCAAGTTTTCGCTCGTCCATTCAAATGACCATCCTCCATTTTTGCTGTTCGCGCGATTTGC
    GGTAGGGAGTTGCAACTTGAATTCACAAACGTTACAAACAAAGGGGCAGCTGTTGAGGTATCCGGAAGTC
    TGTAGGTCATTCCAGTGCTCGGCGGGCTACTTGTCATCACCCAACTAGAATGCGCGGTAACAGGGAGGAA
    AAATACGATGTGGTGTTCCAGGTCCCAGTTTAAACATTTCTTTACCTCTGGAAAAAACGCAGTTGCCAGG
    ATCTGAGGGGTCAACAGAGCTTGTGGCGGTATCGGTGCACTATATGATGGCAATTCACCTTCAGATGATA
    AATATATTTTGGTGTAAAAAAATCGAAATGGAGCAGATGCTGTCAGAATTATTTTCCATGGTGCACTTCT
    GGAAATATCAAACCTTGTCGCAATTGCACAAGGAGAAAACCACTCTTCAATTTTCGATGCCTGTCCTTTC
    TTGAAGCTCCCGTCTGGTTGGGAGTGAATCTCGTTGATATCGGCTAGCCGGTCGACAGAGCATAAAATTG
    TCATGCGCCTGAGGAAGTTCCTTCCATGTTGTATAGAAAGTTGAGGAGCCCGCAAAATAATGTACGTAGA
    AACTGCCAATAACTTTCTGTACGCGGGGGTCATTACCTTTTGTGTAATGATTTCTCTGTAACTGTTATCT
    ATTATTTCAAGAGCCAGTTGGCTGGGGGTCACTCCATCGATGCTCGCCAGGAATGCATTTTGGGGATCTT
    GTTCTGCAGTGATAAGCACCGCATTCATGATAGTAAGAAGCAGGTTATGATTTTTTATCATGGGTTCCCA
    TGGCCTGTCGTGCATAATTTTAAGAATACTGGATGGGATAGAAGTAAGAGCACCACCGACATTCTGAATA
    AAGCGAATATTCGTTGTATAGTTTACTGAATTCGCCCCCCCAAAACACACTGCGACTTGGTCTGCCCATG
    TTTGCGTTTCTGCAATAAACTCGACGATCTCCGAATCAGTTACGTATGCATCGATCGTAAACTTTAGAAA
    TCGAAACCACGCGGCCATAAACCGTGCTGCGAATCTTACAAAAAAAGACTCGTCTATGGTATTCGGGCAA
    CCTGCGATTGCGACCTTCTGCAAAGTTAAAAAGTGTCCCGCGGATATTTGTTCGTCGAAGCTGGCCAGCT
    CTAAGAAATCTTGAGCAGCGGTCGTTACTGCTGTAAACAAATTTGGCCGATAATTTGGTCCAGCTGCGAC
    GTTGATGCGCACAGTTAACCCCTGATCTTCAGCCTTCAGCATATAGGGCCATGACTTCAGGGACGTTTCT
    TTAACCTTCGCGCTGGTTGGTGTAATTATCATCTCTATTTGAGGAGAATGCTGGGTCGCGATTATAAGGG
    TCGCCACATTCAGTCCGATGTTAATCTTAAGATCTATGTCACTAGTAACTGCGAGGCTAATATATCGTGT
    AAACACAAATGGAAAAACAGTTTGTAAAGGATCACTGTAAATTACACGAATCGGAGCGATGATGCTCTCG
    CCCCTATGAACTGAGTTATTTGGTGGAAAGTTGACGAGTTTCGCAGATGTAAGTGCATTCCCCTTGTATC
    CTACCAAAAGTCGATGCTCAAGCTTTGGATCGTTGCTGAATTTTCGTGGTTGGATGGTAGCCTCGCTAGC
    AGAACCCCATCTCGAGTAAGTATAGGCTACGTACAGTTGTCCAAGCAAATCTAGAGCGATCGATAAATTC
    CTGTTAGCGCTTCCAGGAGGCCCAAAGATTAAGTTTCGATCGACAAGGCATAGTTGTGTGATGTGGCCGT
    TTTCGACTGCTGTCGCTATCGCAATGAATTCTTTCGGAGGGGCCAAATTTTCACTGGTGGGGGGCACGAA
    GACAATTTTTGCCTTTGCCTTGTCATCCCCTTTAGCTCTAAGTAATATCGCCAGAATGAGGAAAAATATT
    TCTCTCGCGTGTCCCATCGGCGCGGGTTGCTGGTGAAGCCACGCTCTCTCGAGTAAGAATGAGTACAAAG
    CAAGGAAATGAGTAAAGGACATACTCTTATTGTGAAGGATTATGGAAGCGGAACATTACGAACCCATATC
    AGCATTGTAGCGCTCTACTGCGTCAATTAAGCTCGCGATCGCCGCTCGTTTGGTTGTAAGAGAACTTGCC
    GTCTCGGCAAACTCTAAACATTTCAGTGCACATGCCTCCGGGGTGAGGCCATGTGCTGGTAAGTAAAAAA
    TGCACAAGTTTTTCAATACCGTCGCGAGTTTTTGAACCACAAATGAAAGTACAGTTTTTAATCTTTCCCC
    GTGAACATTTTGCTGATCAAAAGCTAATATTGCAAATAGCGTCTGGTCGATTGAAGGATTGATTTCTGGA
    ACAGTAGCAGTTTCTAAGCACTCTCTCTTGAATTTTAAGAGCGTGGCACTTGTTAAGGCTTCTTGCTCCT
    TCAACAATGCTGGATAAGATGTACGTTGGAGGTAGGTGGTAGTATTCATGAGGCAGATGTACGAGTTACG
    TAATGCACACAAATACGTCCAGTCGACCGTTTCCCCTGGGCGCCCCCTTTGTATTATACGCCGTGCCTGT
    TCGCAAATATCCAAATCCATTAAAACAATGTTGGAGTGTGTTGGAATGTCAGGAATTCCTGACAATAAAG
    TTATTAAATCTCCAAATTCGAGCGCTCCGCTTAGATATTGTGCAACAGGGAAACACAAACATGCCGCGAG
    TGGGTGCCTATCTACGAGGAATAAGACATCATCTGGTCCGGATGCAGCTGCGCTGTAGCAGCGTTCAGAT
    CCCAAATAATTATAAATGACGTGGTTCATTATTCTTAGTGGGGCAGCAATAGTCATCTGAACTTCCGCTA
    CGGCAACCGGAGACGCCTCCCGACATTCAAGTTTTCCGGAAGCCTTTAGGGTTTGTATTTCATTAATTTC
    TTTGATCATATCCGCTCCGCCAAACCATTGGCGCCATGCTTGCATAGGTTCCGCTAAGTATAGACGGCAA
    CCTCTCCAATTTGGCATTTGCATCAACGTCTTTGCAGTGACTGTTTTACCGACTCCGAATGGCCCGTCGA
    CGTAAAGAAGTACAACGCGGCGAAAGTCGGAGTCATCGTTCTCGAACTCGGAGCAAAACTGCACACCACC
    GGAAGTTTTCACGGCGCCAGCTACGGCCA
  • Protein Sequence : Show Sequence
    >gi|57790948|ref|YP_182352.1| thymidine kinase [Gallid herpesvirus 1]
    MAVAGAVKTSGGVQFCSEFENDDSDFRRVVLLYVDGPFGVGKTVTAKTLMQMPNWRGCRLYLAEPMQAWR
    QWFGGADMIKEINEIQTLKASGKLECREASPVAVAEVQMTIAAPLRIMNHVIYNYLGSERCYSAAASGPD
    DVLFLVDRHPLAACLCFPVAQYLSGALEFGDLITLLSGIPDIPTHSNIVLMDLDICEQARRIIQRGRPGE
    TVDWTYLCALRNSYICLMNTTTYLQRTSYPALLKEQEALTSATLLKFKRECLETATVPEINPSIDQTLFA
    ILAFDQQNVHGERLKTVLSFVVQKLATVLKNLCIFYLPAHGLTPEACALKCLEFAETASSLTTKRAAIAS
    LIDAVERYNADMGS
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A thymidine-kinase mutant is attenuated in chickens and induced protection from challenge with wild type GHV-1 (Han et al., 2002).
  • Related Vaccine(s): Gallid herpesvirus 1 UL23 mutant vaccine
4. UL27
  • Gene Name : UL27
  • Sequence Strain (Species/Organism) : Gallid herpesvirus 1
  • NCBI Gene ID : 3239023
  • NCBI Protein GI : 57790952
  • Locus Tag : GaHV1_gp21
  • Protein Accession : YP_182356
  • Taxonomy ID : 10386
  • Gene Starting Position : 39070
  • Gene Ending Position : 41746
  • Gene Strand (Orientation) : -
  • Protein Name : envelope glycoprotein B
  • Protein pI : 6.82
  • Protein Weight : 94517.88
  • Protein Length : 883
  • DNA Sequence : Show Sequence
    >gi|57790931:39070-41746 Gallid herpesvirus 1, complete genome
    TTTTATTAAATAAACTGCATTTAAACTTATTCGTCTTCGCTTTCTTCTGCCCACGAAGGGTATTCGAGCA
    GGGGGTAGTCATCTTCCTTGGTTCGGGGTTTTCTGCGAAATAGGTTTCTCATATTTTTAGCAAAAGCAGA
    AAACCGCGCTTTCTGTCTTCGAGCTTTCTGTTCATCCTTGTGTAGAAGCTCAAGGCCTTTCAGAACTCTG
    GTGGCAAGTATCCTGTCGTCCTCATCACTATCCTCCTCAACCTCCTCCTCATCCTTGTAGTAACGTCTAG
    AGGGTCGTGGAGGAGTTCCGGCCGGGGGAACTGCGCCTGGGAACAGAACCTGAACTGGGTTTGATTTCAG
    GTTCATTACATATTTGAACGCCAGCAGTCCTAAAATAATGCTCACCACCACCGCTATCCCAATTCCGAGT
    GCGGCGAACGGGTTAGAAAGAAATGAGGCGATGCCAGATACTGTAGAAATTACTGCTGCCGCGGCTGTCA
    TCACTACAGTTCCCAATGCCTTTCCTACTTCTCCAAGAGTGTTGCCAAAAAAATCTGCTATTGCTCTAAA
    GATTGCATCTCCCCTATCTCCACGTATTACAGTGTCAATGTCTCTGAACCTTTTGTTATAAATATTTTGA
    TATCTGACCACATCATCATAGTTTAAAGTCCCAGTATCTCTGAGTTCCTCGCGAGTGTATACTTCGACGG
    GCACAAAGTCCAAATCTTCTAGTATAGTGGCGTTCAAGTTGATGAATATGCTCACTTCTTCGATCTCGGA
    AGCATTTACTTGTCTAACAAATGTATAGTCTTCGTAAAGAAGGTAGTTTTCTCCCAACAGAAAGTACCGT
    CTGTGATTGATCATGCATGGTTCTATCAAATTCCGCCCTTGTAAAATTTCATTATGTTCTCCGAGTTGGC
    CTAATATGTCAAGATTGTGGTTTTCTGTTGAGTTCGCAGAAAACTGTGACTCAGGGGAGGACGAATACCT
    GAAAATAAGTACTGGTCTGGTATAGCACATGGTTGGGTCCCCTGGCATGCGCATGGAATCCTGCATCCTA
    ATATTTTCGATTGGAATTTCTATACATTTTGATACCGCTACGATGTCTCCCAATAGCCTGGCGCTTACAG
    GTTGTCCGAACAAAGATGTCATCAGTGAGTTCGGGTTTAGTTTCTTCATCTCATGCCATACAATCAGTTG
    GCGGTTCTGAAGCTCACACCACGCTTCCAACAAATTTCCGATAAGCTCGTTAACATGGGCTTGGATTTTG
    TCGTATGCAAATTGTAACATGGCAAATGTTGCAGAACTGTGGGTAGTAATTCTATCACCCTGAGGTCCAG
    ACTGCAGCGACGCCGTGCGGCGACCTGCGGCTTGGCGACGCTCTCTCCCTCTCGGGAGATGATTTTGTCT
    TTGTGCCTCTTCTAGGTACATTTCAGCCAAGCCATGGCTCATGAGTTTCTGAAATGCGATCAGAAATCCG
    CCACTACCGAGATAGTATTCGATGTCCCCAGAACGGACATGAGTCGAACTATACTTTCTGGCAAAGATGC
    CATCTATGGCCTCCGTGGCTATGGTAGGAACGCATTCAGCCAAATGAAGCCTGCTGATGTTAAAAGGTTG
    TTTTCCGGACGAGAACGTCATAGTCATATCTTTAAGTGAAAAGTGGTAACTGTTTTTGTACGAAACACGA
    ACTGCTTCCGGGACTTCAATCCATTTACTGAGAGTACATACAGATTCCTTTTCTTCCATTGCATCCCAGC
    CTATAGTGAATTGTTCATCTGTTAGAAAGTTTCTTTTTTTAGGGGGTCTTATTTGTCCGGTTTCCAAATC
    CCTGACTTGATAATTTGCGATTTCGAGAAATCTATAGTCTCTGTAGACACTGTGACGCCTTGGTCCGGTC
    GTGTTTTTGGTATAAAAAGGAGAAATTTCTACTGTATCACCTGTCGCCATTCCAAAGTAATCATACGGGT
    ATACAGATCTAGCCTGTAGATATTCCACAACACAGTCGACCGATGTAGACGTTCGGTATCCCAGGGTTTG
    ATGTCGCTTAGTAAAGTTAGTTGTATGAAACGCCTTGGAGACAGTTGATCTTAACAGTGATGGAACCAGG
    GGCAATTTTTTTTCTGCTTCATCATTGTCGTAAGCTTCAAAAAACATGAAATTTTTATGATACGTTGCTT
    TGGATGAGCATTCTCCCGATCGATCAATCCTGACAATTTCATGATAGTCTATTGGAACCCTGGTCACGTA
    CTCATTTGTTATTTGGGGTCTTGAGAATAATGCCCACGTAGTAACTGTGGTTATATGTTTATAGTATAGA
    GTCACATTAAAGACGTACGGGGCAATGTTTTGCTTGAAGACTACGGCAATTCCTTCAGTCATGTTAGTCG
    AATCGGCATGTCGGTGACAATGTCGTGGCTGGGCAAGCCTCGCAACACTGGCGCCAGTTGGAGATGAGCA
    CGCAAAAATTCTGTTTCTAATCTGGGGTTCTTTCGGTGCCCCCGACCCAATGGCTTCGGAGAAAGAGATT
    TTTCCAACATCCATGCTGGCTGTATCACGAGGGTCTATTATTCCAGCAATTCCGTGTGAATCTTGAGATA
    GGGTAGATGGGATCAGGATTGCCACGCACACGCAGATCAGCATTTTCAAGCTAGCCATGTCAATGTTCAC
    GGCGATGTAGGATTGCA
  • Protein Sequence : Show Sequence
    >gi|57790952|ref|YP_182356.1| envelope glycoprotein B [Gallid herpesvirus 1]
    MQSYIAVNIDMASLKMLICVCVAILIPSTLSQDSHGIAGIIDPRDTASMDVGKISFSEAIGSGAPKEPQI
    RNRIFACSSPTGASVARLAQPRHCHRHADSTNMTEGIAVVFKQNIAPYVFNVTLYYKHITTVTTWALFSR
    PQITNEYVTRVPIDYHEIVRIDRSGECSSKATYHKNFMFFEAYDNDEAEKKLPLVPSLLRSTVSKAFHTT
    NFTKRHQTLGYRTSTSVDCVVEYLQARSVYPYDYFGMATGDTVEISPFYTKNTTGPRRHSVYRDYRFLEI
    ANYQVRDLETGQIRPPKKRNFLTDEQFTIGWDAMEEKESVCTLSKWIEVPEAVRVSYKNSYHFSLKDMTM
    TFSSGKQPFNISRLHLAECVPTIATEAIDGIFARKYSSTHVRSGDIEYYLGSGGFLIAFQKLMSHGLAEM
    YLEEAQRQNHLPRGRERRQAAGRRTASLQSGPQGDRITTHSSATFAMLQFAYDKIQAHVNELIGNLLEAW
    CELQNRQLIVWHEMKKLNPNSLMTSLFGQPVSARLLGDIVAVSKCIEIPIENIRMQDSMRMPGDPTMCYT
    RPVLIFRYSSSPESQFSANSTENHNLDILGQLGEHNEILQGRNLIEPCMINHRRYFLLGENYLLYEDYTF
    VRQVNASEIEEVSIFINLNATILEDLDFVPVEVYTREELRDTGTLNYDDVVRYQNIYNKRFRDIDTVIRG
    DRGDAIFRAIADFFGNTLGEVGKALGTVVMTAAAAVISTVSGIASFLSNPFAALGIGIAVVVSIILGLLA
    FKYVMNLKSNPVQVLFPGAVPPAGTPPRPSRRYYKDEEEVEEDSDEDDRILATRVLKGLELLHKDEQKAR
    RQKARFSAFAKNMRNLFRRKPRTKEDDYPLLEYPSWAEESEDE
  • Molecule Role : Protective antigen
5. UL47
  • Gene Name : UL47
  • Sequence Strain (Species/Organism) : Gallid herpesvirus 1
  • NCBI Gene ID : 3239064
  • NCBI Protein GI : 57790998
  • Locus Tag : GaHV1_gp67
  • Genbank Accession : EU104855
  • Protein Accession : YP_182402
  • Taxonomy ID : 10386
  • Gene Starting Position : 126615
  • Gene Ending Position : 129614
  • Gene Strand (Orientation) : +
  • Protein Name : tegument protein VP13/14
  • Protein pI : 9.89
  • Protein Weight : 65621.89
  • Protein Length : 623
  • DNA Sequence : Show Sequence
    >gi|57790931:126615-129614 Gallid herpesvirus 1, complete genome
    AATGACCTTGCCCCATCGATTAACGAAAAGACCTTTCGCGCGTCGATTCTGCTCGGTCTTTGTGATACAT
    TATAGTGAGACTAAACTCGACCGATATAACAAGACAATGTTACTCTATAGACCGGACTCAACCATGCGGC
    ATAGCGGAGGCGACGCAAATCACAGAGGGATAAGGCCGAGGCGGAAATCTATTGGAGCGTTTAGCGCGCG
    CGAAAAGACTGGAAAACGAAATGCGCTGACGGAAAGCAGCTCCTCCTCCGACATGCTAGATCCGTTTTCC
    ACGGATAAGGAATTTGGCGGTAAGTGGACGGTAGACGGACCTGCCGACATTACTGCCGAGGTCCTTTCTC
    AGGCATGGGACGTTCTCCAATTAGTGAAGCATGAAGATGCGGAGGAGGAGAGAGTGACTTATGAGTCCAA
    ACCGACCCCGATACAGCCGTTCAATGCCTGGCCGGACGGGCCGAGTTGGAACGCGCAGGATTTTACTCGA
    GCGCCAATAGTTTATCCCTCTGCGGAGGTATTGGACGCAGAGGCGTTGAAAGTAGGGGCATTCGTTAGCC
    GAGTTTTACAATGTGTACCGTTCACGCGATCAAAGAAAAGCGTTACGGTGCGGGATGCGCAGTCGTTTTT
    GGGGGACTCGTTCTGGAGAATAATGCAGAACGTTTACACGGTTGTCTTACGACAGCACATAACTCGACTC
    AGGCACCCTTCCAGCAAAAGCATTGTTAACTGCAACGACCCTCTATGGTACGCCTACGCGAATCAATTTC
    ACTGGAGAGGAATGCGCGTGCCGTCGCTTAAATTAGCCTCTCCCCCGGAGGAGAATATTCAACACGGCCC
    AATGGCCGCCGTTTTTAGAAACGCGGGGGCTGGTCTGTTCCTGTGGCCTGCCATGCGCGCAGCCTTTGAA
    GAGCGCGACAAGCGACTGTTAAGAGCATGCCTGTCTTCACTCGATATCATGGACGCAGCCGTCCTCGCGT
    CGTTTCCATTTTACTGGCGCGGCGTCCAAGACACCTCGCGCTTCGAGCCTGCGCTGGGCTGTTTGTCAGA
    GTACTTTGCACTAGTGGTGTTACTGGCCGAGACGGTCTTAGCGACCATGTTCGACCACGCACTGGTATTC
    ATGAGGGCGCTGGCAGACGGCAATTTCGATGACTATGACGAAACTAGATATATAGACCCCGTTAAAAACG
    AGTACCTGAACGGAGCCGAGGGTACTCTGTTACGGGGCATAGTGGCCTCCAACACCGCTCTGGCGGTGGT
    TTGCGCAAACACCTATTCGACGATAAGAAAACTCCCGTCCGTGGCAACTAGCGCGTGCAATGTTGCCTAC
    AGGACCGAAACGCTGAAAGCGAGGCGCCCTGGCATGAGCGACATATACCGGATATTACAAAAAGAGTTTT
    TCTTTTACATTGCGTGGCTCCAGAGGGTTGCAACACACGCAAATTTCTGTTTAAACATTCTGAAGAGAAG
    CGTGGATACGGGGGCCCCGCCATTTTTGTTCAGGGCCAGCTCGGAGAAGCGGCTGCAGCAGTTAAATAAA
    ATGCTCTGCCCCCTTCTCGTGCCGATTCAATATGAAGACTTTTCGAAGGCCATGGGGTCTGAGCTCAAGA
    GGGAAAAGTTAGAGACATTCGTTAAAGCTATTTCCAGCGACAGGGACCCGAGGGGGTCCTTAAGATTTCT
    CATTTCGGACCATGCAAGGGAAATTATTGCAGACGGAGTACGGTTTAAGCCGGTGATAGACGAGCCGGTT
    CGGGCTTCAGTTGCGCTGAGTACCGCTGCCGCTGGGAAAGTGAAAGCGCGACGCTTAACCTCAGTTCGCG
    CGCCCGTACCGGGCGCAGGCGCCGTTTCCGCGCGCCGGAAATCGGAAATATGATAAAAATGCTTGGCATT
    TGCGGGCGAAGAGGCGTGATCTGAAGGGCTCCACAATGACGTAACTGAGCTACGCATCCCTATAAAGTGT
    ACCCGCTGACCGCTAGCCCATACAGTGTTACAGGAGGGGAGAGAGACAACTTCAGCTCGAAGTCTGAAGA
    GACATCATGAGCGGCTTCAGTAACATAGGATCGATTGCCACCGTTTCCCTAGTATGCTCGCTTTTGTGCG
    CATCTGTATTAGGGGCGCCGGTACTGGACGGGCTCGAGTCGAGCCCTTTCCCGTTCGGGGGCAAAATTAT
    AGCCCAGGCGTGCAACCGCACCACGATTGAGGTGACGGTCCCGTGGAGCGACTACTCTGGTCGCACCGAA
    GGAGTGTCAGTCGAGGTGAAATGGTTCTACGGGAATAGTAATCCCGAAAGCTTCGTGTTCGGGGTGGATA
    GCGAAACGGGCAGTGGACACGAGGACCTGTCTACGTGCTGGGCTCTAATCCATAATCTGAACGCGTCTGT
    GTGCAGGGCGTCTGACGCCGGGATACCTGATTTCGACAAGCAGTGCGAAAAAGTGCAGAGAAGACTGCGC
    TCCGGGGTGGAACTTGGTAGTTACGTGTCTGGCAATGGATCCCTGGTGCTGTACCCAGGGATGTACGATG
    CCGGCATCTACGCCTACCAGCTCTCAGTGGGTGGGAAGGGATATACCGGGTCTGTTTATCTAGACGTCGG
    ACCAAACCCCGGATGCCACGACCAGTATGGGTACACCTATTACAGCCTGGCCGACGAGGCGTCAGACTTA
    TCATCTTATGACGTAGCCTCGCCCGAACTCGACGGTCCTATGGAGGAAGATTATTCCAATTGTCTAGACA
    TGCCCCCGCTACGCCCATGGACAACCGTTTGTTCGCATGACGTCGAGGAGCAGGAAAACGCCACGGACGA
    GCTTTACCTATGGGACGAGGAATGCGCCGGTCCGCTGGACGAGTACGTCGACGAAAGGTCAGAGACGATG
    CCCAGGATGGTTGTCTTTTCACCGCCCTCTACGCTCCAGCAGTAGCCACCCGAGAGTGTTTTTTGTGAGC
    GCCCACGCAACATACCTAACTGCTTCATTTCTGATCAATTATTGCGTATTGAATAAATAA
  • Protein Sequence : Show Sequence
    >gi|57790998|ref|YP_182402.1| tegument protein VP13/14 [Gallid herpesvirus 1]
    MTLPHRLTKRPFARRFCSVFVIHYSETKLDRYNKTMLLYRPDSTMRHSGGDANHRGIRPRRKSIGAFSAR
    EKTGKRNALTESSSSSDMLDPFSTDKEFGGKWTVDGPADITAEVLSQAWDVLQLVKHEDAEEERVTYESK
    PTPIQPFNAWPDGPSWNAQDFTRAPIVYPSAEVLDAEALKVGAFVSRVLQCVPFTRSKKSVTVRDAQSFL
    GDSFWRIMQNVYTVVLRQHITRLRHPSSKSIVNCNDPLWYAYANQFHWRGMRVPSLKLASPPEENIQHGP
    MAAVFRNAGAGLFLWPAMRAAFEERDKRLLRACLSSLDIMDAAVLASFPFYWRGVQDTSRFEPALGCLSE
    YFALVVLLAETVLATMFDHALVFMRALADGNFDDYDETRYIDPVKNEYLNGAEGTLLRGIVASNTALAVV
    CANTYSTIRKLPSVATSACNVAYRTETLKARRPGMSDIYRILQKEFFFYIAWLQRVATHANFCLNILKRS
    VDTGAPPFLFRASSEKRLQQLNKMLCPLLVPIQYEDFSKAMGSELKREKLETFVKAISSDRDPRGSLRFL
    ISDHAREIIADGVRFKPVIDEPVRASVALSTAAAGKVKARRLTSVRAPVPGAGAVSARRKSEI
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A UL47 mutant in avian infectious laryngotracheitis virus is attenuated and provides protection in chicken against subsequent challenge infection with virulent ILTV (Helferich et al., 2007).
  • Related Vaccine(s): Gallid herpesvirus 1 UL47 mutant vaccine
III. Vaccine Information
1. Avian Encephalomyelitis-Fowl Pox-Laryngotracheitis Live Virus, Live Fowl Pox Vector Vaccine (USDA: 10S1.R0)
a. Manufacturer:
Biomune Company
b. Vaccine Ontology ID:
VO_0002038
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
2. Fowl Laryngotracheitis Modified Live Virus Vaccine (USDA: 1601.01)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001671
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
3. Fowl Laryngotracheitis Modified Live Virus Vaccine (USDA: 1601.02)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001672
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
4. Fowl Laryngotracheitis Modified Live Virus Vaccine (USDA: 1601.11)
a. Manufacturer:
Wyeth, Lohmann Animal Health International, Merial, Inc.
b. Vaccine Ontology ID:
VO_0001673
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
5. Fowl Laryngotracheitis Modified Live Virus Vaccine (USDA: 1601.13)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001674
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
6. Fowl Laryngotracheitis Modified Live Virus Vaccine (USDA: 1601.14)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001675
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
7. Fowl Laryngotracheitis Modified Live Virus Vaccine (USDA: 1601.15)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001676
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
8. Fowl Laryngotracheitis-Marek's Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 16J1.R1)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002141
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
9. Fowl Laryngotracheitis-Marek's Disease Serotypes 2 & 3, Modified Live & Live Marek's Disease Vector Vaccine (USDA: 16J1.R2)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002142
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
10. Fowl Pox-Laryngotracheitis Live Fowl Pox Vector Vaccine (USDA: 1F31.R0)
a. Manufacturer:
Biomune Company
b. Vaccine Ontology ID:
VO_0002202
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
11. Gallid herpesvirus 1 UL0 mutant vaccine
a. Vaccine Ontology ID:
VO_0002966
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Chicken
e. Gene Engineering of UL0
  • Type: Gene mutation
  • Description: This UL0 mutant is from Gallid herpesvirus 1 (Veits et al., 2003).
  • Detailed Gene Information: Click here.
f. Immunization Route
Eye drop
g. Chicken Response
  • Persistence: A UL0 mutant is attenuated in chickens (Veits et al., 2003).
  • Efficacy: A UL0 mutant induces significant protection in chickens from challenge with wild type gallid herpesvirus 1 (Veits et al., 2003).
12. Gallid herpesvirus 1 UL23 mutant vaccine
a. Vaccine Ontology ID:
VO_0002967
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Chicken
e. Gene Engineering of UL23
  • Type: Gene mutation
  • Description: This UL23 mutant is from Gallid herpesvirus 1 (Han et al., 2002).
  • Detailed Gene Information: Click here.
f. Immunization Route
Intraocular immunization
g. Chicken Response
  • Persistence: A UL23 mutant is attenuated in chickens (Han et al., 2002).
  • Efficacy: A UL23 mutant induces significant protection in chickens from challenge with wild type GHV-1 (Han et al., 2002).
13. Gallid herpesvirus 1 UL47 mutant vaccine
a. Vaccine Ontology ID:
VO_0002968
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Chicken
e. Gene Engineering of UL47
f. Immunization Route
Intratracheal immunization
g. Chicken Response
14. Laryngotracheitis DNA Vaccine encoding gB
a. Vaccine Ontology ID:
VO_0004565
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of gB
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
pcDNA3.1(+) (Chen et al., 2011)
f. Immunization Route
Intramuscular injection (i.m.)
g. Baboon Response
  • Vaccination Protocol: At 21 days of age, the chickens were randomly divided into four groups of 20 chickens each. Chickens in group 1 were administered 150 μg plasmid pgB alone by intramuscular injection into the quadriceps muscle. Chickens in group 2 were immunized with 150 μg plasmid pgB plus 150 μg plasmid pIL-18. Chickens in group 3, which served as a negative-control group, were immunized with 150 μg plasmid pcDNA3.1(+). Chickens in group 4 were immunized with 0.5 ml sterile PBS alone as a blank control (Chen et al., 2011).
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: Compared with the chickens in the pcDNA3.1(+) and PBS group, the chickens in the pgB with or without pIL-18 groups showed significantly increased levels of anti-ILTV antibodies with subsequent vaccination. In addition, an enhanced T-cell proliferative response to gB was clearly observed in the groups immunized with pgB alone or with pgB plus pIL-18 (Chen et al., 2011).
  • Challenge Protocol: At 15 days after the booster immunization, all of the chickens were challenged intratracheally with 150 EID50 virulent ILTV CG strain (Chen et al., 2011).
  • Efficacy: The protection rates in the pgB and pgB plus pIL-18 groups were 60 and 80 %, respectively (Chen et al., 2011).
IV. References
1. Chen et al., 2011: Chen HY, Zhang HY, Li XS, Cui BA, Wang SJ, Geng JW, Li K. Interleukin-18-mediated enhancement of the protective effect of an infectious laryngotracheitis virus glycoprotein B plasmid DNA vaccine in chickens. Journal of medical microbiology. 2011; 60(Pt 1); 110-116. [PubMed: 20829398].
2. Fuchs et al., 2007: Fuchs W, Veits J, Helferich D, Granzow H, Teifke JP, Mettenleiter TC. Molecular biology of avian infectious laryngotracheitis virus. Veterinary research. 2007; 38(2); 261-279. [PubMed: 17296156].
3. Han et al., 2002: Han MG, Kweon CH, Mo IP, Kim SJ. Pathogenicity and vaccine efficacy of a thymidine kinase gene deleted infectious laryngotracheitis virus expressing the green fluorescent protein gene. Archives of virology. 2002; 147(5); 1017-1031. [PubMed: 12021870].
4. Helferich et al., 2007: Helferich D, Veits J, Teifke JP, Mettenleiter TC, Fuchs W. The UL47 gene of avian infectious laryngotracheitis virus is not essential for in vitro replication but is relevant for virulence in chickens. The Journal of general virology. 2007; 88(Pt 3); 732-742. [PubMed: 17325345].
5. Veits et al., 2003: Veits J, Lüschow D, Kindermann K, Werner O, Teifke JP, Mettenleiter TC, Fuchs W. Deletion of the non-essential UL0 gene of infectious laryngotracheitis (ILT) virus leads to attenuation in chickens, and UL0 mutants expressing influenza virus haemagglutinin (H7) protect against ILT and fowl plague. The Journal of general virology. 2003; 84(Pt 12); 3343-3352. [PubMed: 14645915].