VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Orf Virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. ORFV011 (Protective antigen)
    2. ORFV059 (Protective antigen)
  3. Vaccine Information
    1. Ovine Ecthyma Live Virus Vaccine
    2. Ovine Ecthyma Live Virus Vaccine
  4. References
I. General Information
1. NCBI Taxonomy ID:
10258
2. Disease:
Orf disease, Sore mouth (Ovine Ecthyma)
3. Introduction
Orf is an exanthemous disease caused by a parapox virus and occurring primarily in sheep and goats. It is also known as contagious pustular dermatitis, infectious labial dermatitis, ecthyma contagiosum, and sheep pox, thistle disease and scabby mouth. Orf virus can also infect humans. It has been recorded since the late 19th century and has been reported from most sheep- or goat-raising areas including those in Europe, the Middle East, the United States, Africa, Asia, Alaska, South America, Canada, New Zealand and Australia. Orf is spread by fomites and direct contact. In some environments infection is injected by scratches from thistles of both growing and felled plants. Symptoms include papules and pustules on the lips and muzzle, and less commonly in the mouth of young lambs and on the eyelids, feet, and teats of ewes. The lesions progress to thick crusts which may bleed. Orf in the mouths of lambs may prevent suckling and cause weight loss, and can infect the udder of the mother ewe, thus potentially leading to mastitis. Sheep are prone to reinfection. Occasionally the infection can be extensive and persistent if the animal does not produce an immune response (Wiki: Orf disease).
4. Host Ranges and Animal Models
Primarily, orf is a disease of sheep and goats although it has been reported as a natural disease in the following: humans, steenbok and alpacas, chamois and thar, reindeer, musk ox, the dog, the cat, the mountain goat, bighorn sheep, dall sheep, and the red squirrel (Wiki: Orf disease).
1. ORFV011
  • Gene Name : ORFV011
  • Sequence Strain (Species/Organism) : Orf Virus
  • NCBI Protein GI : AGY41811
  • Other Database IDs : CDD:177506
    CDD:197205
    CDD:301585
    CDD:197546
    CDD:197206
  • Taxonomy ID : 10258
  • Protein Name : ORFV011
  • Protein pI : 6.42
  • Protein Weight : 38341
  • Protein Length : 417
  • Protein Note : palmytilated EEV membrane glycoprotein; Provisional
  • Protein Sequence : Show Sequence
    >AGY41811.1 ORFV011 [Orf virus]
    MWPFSSIPVGADCRVVETLPAEVASLAQGNMSTLDCFTAIAESAKKFLYICSFCCNLSSTKEGVDVKDKL
    CTLAKEGVDVTLLVDVQSKDKDADELREAGVNYYKVKVSTREGVGNLLGSFWISDAGHWYVGSASLTGGS
    VSTIKNLGLYSTNKHLAWDLMNRYNTFYSMIVEPKVPFTRLCCAVVTPTATNFHLNHSGGGVFFSDSPER
    FLGFYRTLDEDLVLHRIENAKNSIDLSLLSMVPVIKHAGAVEYWPRIIDALLRAAIDRGVRVRVIITEWK
    NADPLSVSAARSLDDFGVGSVDMSVRKFVVPGRDDAANNTKLLIVDDTFAHLTVANLDGTHYRYHAFVSV
    NAEKGDIVKDLSAVFERDWRSEFCKPIN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Zhao et al., 2011)
2. ORFV059
  • Gene Name : ORFV059
  • Sequence Strain (Species/Organism) : Orf Virus
  • NCBI Protein GI : ALF04630
  • Other Database IDs : CDD:222919
  • Taxonomy ID : 10258
  • Protein Name : ORFV059
  • Protein pI : 5.7
  • Protein Weight : 35132.14
  • Protein Length : 387
  • Protein Note : ORF059 IMV protein VP55; Provisional
  • Protein Sequence : Show Sequence
    >ALF04630.1 ORFV059, partial [Orf virus]
    MDPPEITAYIIGVAEGRGTKEVFPTLPYLVGLADDPPKPQPAPAPSPAPAPAPSPAPAPSPAPAPAPKPS
    PPAPHPKGDHVLKAVEWKDVDSKDYPHFFTDMCKSTCPKEMQRRAAHHLNLWESISAGTVSTKYSDDDFI
    LVVDNDMTFRKPEMVKPLIEAMKTNGWYMAQLKETYMTGALATNVPGTGDPELMVYPGGYDVSLDAYIIN
    VGGMKKLYDAIIKDGGLRSGLLTEVFTLEKRLSLARVVLSGAEQVVYPEYYIQVKTRLGGAPSLWSLLAT
    WLARFWPGAIYFLTTPLFSFMGLFDVDVVDVFILAYLLVLVLLLPNSRLLWFIAGLLVTA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Zhao et al., 2011)
III. Vaccine Information
1. Ovine Ecthyma Live Virus Vaccine
a. Manufacturer:
Colorado Serum Company
b. Vaccine Ontology ID:
VO_0004209
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Sheep
2. Ovine Ecthyma Live Virus Vaccine
a. Manufacturer:
Texas Agricultural Experiment Station
b. Vaccine Ontology ID:
VO_0004210
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Sheep
IV. References
1. Wiki: Orf disease: Wiki: Orf Disease [http://en.wikipedia.org/wiki/Orf_disease]
2. Zhao et al., 2011: Zhao K, He W, Gao W, Lu H, Han T, Li J, Zhang X, Zhang B, Wang G, Su G, Zhao Z, Song D, Gao F. Orf virus DNA vaccines expressing ORFV 011 and ORFV 059 chimeric protein enhances immunogenicity. Virology journal. 2011; 8; 562. [PubMed: 22204310].