VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Pasteurella multocida

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. OmpA (Protective antigen)
    2. ompH (Protective antigen)
    3. ompH (Protective antigen)
    4. aroA (Virmugen)
  3. Vaccine Related Host Genes
    1. IgG
    2. IgM
  4. Vaccine Information
    1. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.20)
    2. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.21)
    3. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 4109.20)
    4. Bovine Rhinotracheitis-Parainfluenza 3 Killed Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin (USDA: 4265.00)
    5. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 43S5.20)
    6. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 43T5.20)
    7. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.20)
    8. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.21)
    9. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus-Mannheimia Haemolytica-Pasteurella Multocida Modified Live Virus, Avirulent Live Culture Vaccine (USDA: 11A8.22)
    10. Bovine Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 4C95.20)
    11. Mannheimia Haemolytica-Pasteurella Multocida Avirulent Live Culture Vaccine (USDA: 1861.01)
    12. P. multocida DNA vaccine pcDNA-OMPH + pcDNA-OMPA
    13. P. multocida DNA vaccine pcDNA-OMPH/OMPA
    14. P. multocida rOmpH Vaccine
    15. Pasteurella multocida aroA mutant vaccine
    16. Pasteurella Multocida Avirulent Live Culture, Avian Isolate Vaccine (USDA: 1871.01)
    17. Pasteurella Multocida Avirulent Live Culture, Avian Isolate Vaccine (USDA: 1871.02)
    18. Pasteurella Multocida Avirulent Live Culture, Avian Isolate Vaccine (USDA: 1871.03)
    19. Pasteurella Multocida Avirulent Live Culture, Avian Isolate Vaccine (USDA: 1871.04)
    20. Pasteurella Multocida Avirulent Live Culture, Avian Isolate Vaccine (USDA: 1871.05)
    21. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Bordetella Bronchiseptica-Clostridium Perfringens Type C-Erysipelothrix Rhusiopathiae-Escherichia Coli-Pasteurella Multocida Bacterin-Toxoid (USDA: 49T9.21)
  5. References
I. General Information
1. NCBI Taxonomy ID:
747
2. Disease:
Pasteurellosis, fowl cholera
3. Introduction
Pasteurella multocida is a Gram-negative, non-motile coccobacillus that is penicillin-sensitive and belongs to the Pasteurellaceae family. It can cause a zoonotic infection in humans, which typically is a result of bites or scratches from domestic pets. Many mammals and fowl harbor it as part of their normal respiratory microbiota, displaying asymptomatic colonization. P. multocida is the most common cause of infection from animal injuries (pneumonia in cattle and pigs, atrophic rhinitis in pigs and goats, and wound infections after dog/cat-bites.) A high leukocyte and neutrophil count is typically observed, leading to an inflammatory reaction at the infection site (generally a diffuse localized cellulitis). It can also infect other locales, such as the respiratory tract. In more serious cases, a bacteremia can result, causing an osteomyelitis or endocarditis. The bacteria may also cross the blood-brain barrier and cause meningitis (Wiki: P. multocida).
4. Microbial Pathogenesis
In birds, P. multocida is believed to enter through the respiratory tract tissues of the host. P. multocida has been shown to adhere to air sac macrophages. The mode of transfer from the lungs to the bloodstream is poorly understood, but heterophils may play a role in the process (Harper et al., 2006).
5. Host Ranges and Animal Models
P. multocida causes can cause disease in fowl, pigs, cattle, rabbits and humans (Harper et al., 2006).
6. Host Protective Immunity
The first systemic host defence used against most invading bacteria involves the innate immune system and includes phagocytosis and bactericidal properties of serum components such as complement. However, P. multocida has mechanisms to evade this system, including the presence of a capsule. Active immunity against P. multocida infection is mainly humoral; vaccination of birds with killed P. multocida stimulates protection against homologous challenge, and opsonization studies in mice have shown that bactericidal antibodies are produced (Harper et al., 2006).
1. aroA
  • Gene Name : aroA
  • NCBI Protein GI : 581456
  • Other Database IDs : CDD:179423
    CDD:30129
    GOA:Q04570
    InterPro: IPR001986
    InterPro: IPR006264
    InterPro: IPR013792
    InterPro: IPR023193
    UniProtKB/UniProt: Q04570
  • Taxonomy ID : 747
  • Gene Strand (Orientation) : ?
  • Protein Length : 441
  • Protein Note : 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional
  • Protein Sequence : Show Sequence
    >gi|581456|emb|CAA78480.1| aroA [Pasteurella multocida]
    MIKDATAITLNPISYIEGEVRLPGSKSLSNRALLLSALAKGKTTLTNLLDSDDVRHMLNALKELGVTYQL
    SEDKSVCEIEGLGRAFEWQSGLALFLGNAGTAMRPLTAALCLSTPNREGKNEIVLTGEPRMKERPIQHLV
    DALCQAGAEIQYLEQEGYPPIAIRNTGLKGGRIQIDGSVSSQFLTALLMAAPMAEADTEIEIIGELVSKP
    YIDITLKMMQTFGVEVENQAYQRFLVKGHQQYQSPHRFLVEGDASSASYFLAAAAIKGKVKVTGVGKNSI
    QGDRLFADVLEKMGAHITWGDDFIQVEKGNLKGIDMDMNHIPDAAMTIATTALFAEGETVIRNIYNWRVK
    ETDRLTAMATELRKVGAEVEEGEDFIRIQPLNLAQFQHAELNIHDHRMAMCFALIALSKTSVTILDPSCT
    AKTFPTFLILFTLNTREVAYR
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An aroA mutant is highly attenuated in calves and induces significant protection from challenge with wild type P. multocida (Dagleish et al., 2007).
  • Related Vaccine(s): Pasteurella multocida aroA mutant vaccine
2. OmpA
  • Gene Name : OmpA
  • Sequence Strain (Species/Organism) : Pasteurella multocida strain 95010872
  • NCBI Nucleotide GI : 49182347
  • NCBI Protein GI : 49182348
  • Protein Accession : AAT57676.1
  • Taxonomy ID : 747
  • Gene Strand (Orientation) : ?
  • Protein Name : OmpA
  • Protein Note : Pm50OmpA
  • DNA Sequence : Show Sequence
    >gi|49182347|gb|AY643794.1| Pasteurella multocida strain 95010872 OmpA gene, complete cds
    ATGAAAAAAACAGCAATTGCATTGACTATCGTTGCACTAGCCGTGGCTTCAGTTGCACAAGCTGCACCAC
    AACCTAACACATTCTATGTAGGTGCTAAAGCAGGTTGGGCATCTTTCCACGATGGTTTAAATCAAGCTAA
    ATATCTTGAAGCTCCTGAGGCTACATTTGGCTTTAAACGTAATAGCGTTACTTATGGCGTGTTTGGTGAA
    TATCAAATCACTGATAATTTTGCAGTAGAGTTAGGCTATGATGATTTTGGTCGTGCGAAGTTACGTATGG
    CTGAAAAAGATCAAAAAGCAAAAGATGCAGCAAAACACACTAACCATGGTGCGCATTTAAGCTTAAAAGC
    AAGCTATCCTGTACTTGATGGTTTAGATATTTATGCGCGTGTTGGAGCAGCATTAATTCGCTCAGATTAT
    AAAGTGTATGATCATTCTGACCCAGCAAAATTACCACAATTTAAGAGAACTCATAGCACCCAAGTTTCTC
    CAGTATTCGCAGGTGGTTTAGAATATGCGTTTATGCCTGAGTTAGCTTTACGTGTTGAATACCAATGGGT
    AAACAATGTAGGTAAAGTTAAAGATGTTCTTGGAGAACGCGTAGATTACAGACCAGATATCGGCTCTGTA
    ACAGCTGGTTTCGGTCAATCTGTTTATGTACCAGAAGTTGTGAGCAAAACATTCACATTAAACTCTGATG
    TGACATTCGGTTTCGATAAAGCTGACTTAAAACCAGCTGCACAAAACGTGTTAGATGGTATCTACGGTGA
    AATCGCCCAGTTAAAATCTGCCTCTGTTGCAGTTGCTGGTTACACAGACCGTTTAGGTTCTGATGCATAC
    AACTTAAAATTATCACAACGTCGTGCTGACACTGTGGCTAACTACTTAGTAGCGAAAGGTGTTGCACAAA
    ACGCTATCAGTGCAACAGGTCATGGTGAAGCGAACCCTGTAACTGGTAACAAATGTGATTCAGTTAAAGG
    TCGTAAAGCACTTATCGCATGTTTAGCTGACGATCGTCGCGTTGAAATCGCTGTTAAAGGTAACAAATAA
  • Molecule Role : Protective antigen
  • Related Vaccine(s): P. multocida DNA vaccine pcDNA-OMPH + pcDNA-OMPA , P. multocida DNA vaccine pcDNA-OMPH/OMPA
3. ompH
  • Gene Name : ompH
  • NCBI Nucleotide GI : 2745957
  • NCBI Protein GI : 2745958
  • Protein Accession : AAC02243.1
  • Other Database IDs : CDD:30071
  • Taxonomy ID : 747
  • Gene Strand (Orientation) : ?
  • Protein Name : outer membrane protein
  • Protein Length : 353
  • Protein Note : OmpH
  • DNA Sequence : Show Sequence
    >gi|2745957|gb|U50907.1|PMU50907 Pasteurella multocida strain X-73 outer membrane protein (ompH) gene, complete cds
    AAATATAAATAAAATTTGGGTGAAGTGAGAAATAGAGGCATTTACCCGATGTTTTTATCTTTGATTTATA
    CTATTTTTGTTTTTAAATCAATGTGTTATGTTTTAAAAGAAAAGTTCTAAAGGAAATAAAATTTTTAATA
    AATGTGATCTTTTTAACACTTTTTTAACCCTGAAAAAACCGCTGATTTTTTGTAACATGTTGTTTTTAAA
    GGATAAGGTAAAAAAAAAGACAAACCTATTTTGTTTTGACAAGAAAACGGAGCTTTGCTATCTTGCATTT
    GCAAAAATGTGCAGACGACTTATCGTCTGTTAGTCGATTTTAGGTTGATTGAGTGATTGGCAACAATCAT
    TTAATCGAATTATAAAACTCCAAAAACAAGGTAGTGATACTATGAAAAAGACAATCGTAGCATTAGCAGT
    CGCAGCAGTAGCAGCAACTTCAGCAAACGCAGCAACAGTTTACAATCAAGACGGTACCAAAGTTGATGTA
    AACGGTTCTTTACGTTTAATCCTTAAAAAAGAAAAAAATGAGCGCGGTGATTTAGTGGATAACGGTTCAC
    GCGTTTCATTCAAAGCATCTCATGATTTAGGCGAAGGCTTAAGCGCATTAGCTTATACAGAACTTCGTTT
    TAGTAAAAATGTACCCGTGCAAGTAAAAGACCAACAAGGTGAAGTAGTACGTGAGTATGAGGTTGAGAAA
    CTTGGTAACAATGTTCACGTAAAACGTCTTTATGCGGGTTTCGCGTATGAAGGTTTAGGTACATTAACAT
    TCGGTAACCAATTAACTATCGGTGATGATGTTGGTCTATCTGACTATACCTATTTCAACAGTGGTATTAA
    TAACCTCCTTTCTAGCGGTGAAAAAGCAATTAACTTTAAATCTGCAGAATTCAATGGTTTCACATTTGGT
    GGTGCGTATGTCTTCTCTGCTGATGCTGACAAACAAGCATTACGTGATGGTCGCGGTTTCGTTGTAGCAG
    GTTTATACAACAGAAAAATGGGTGATGTTGGTTTTGCATTCGAAGCCGGTTATAGCCAAAAATATGTGAA
    ACAAGAAGTTGAACAGAATCCGCCAGCAGCACAAAAAGTGTTTAAAGATGAAAAAGAGAAAGCTTTCATG
    GTGGGTGCTGAGTTATCATATGCTGGTTTAGCGCTTGGTGTTGACTACGCACAATCTAAAGTGACTAACG
    TAGATGGTAAAAAACGTGCTCTTGAAGTGGGTTTAAATTATGACCTTAACGACAGAGCGAAAGTTTACAC
    AGACTTCATCTGGGAAAAAGAAGGTCCTAAAGGTGATGTTACAAGAAACCGTACTGTCGCTGTAGGTTTT
    GGTTACAAACTTCACAAACAAGTGGAAACTTTTGTTGAAGCAGCTTGGGGTAGAGAGAAAGACTCTGATG
    GTGTAACAACAAAAAACAACGTAGTAGGTACAGGTTTACGCGTACACTTCTAATTTTTGTTAGAATCTGA
    AAAAAGCCAGTGTTAAACACTGGCTTTTTATTGGGTTTTATTTGTTTTACTTACAATAAATTAGGATTTT
    GAAAGTCGTTACGCGGTCATCTTTCTCAAAATAATACATATCAATATGTTGCAAGGAATGGATC
  • Protein Sequence : Show Sequence
    >gi|2745958|gb|AAC02243.1| outer membrane protein [Pasteurella multocida]
    MKKTIVALAVAAVAATSANAATVYNQDGTKVDVNGSLRLILKKEKNERGDLVDNGSRVSFKASHDLGEGL
    SALAYTELRFSKNVPVQVKDQQGEVVREYEVEKLGNNVHVKRLYAGFAYEGLGTLTFGNQLTIGDDVGLS
    DYTYFNSGINNLLSSGEKAINFKSAEFNGFTFGGAYVFSADADKQALRDGRGFVVAGLYNRKMGDVGFAF
    EAGYSQKYVKQEVEQNPPAAQKVFKDEKEKAFMVGAELSYAGLALGVDYAQSKVTNVDGKKRALEVGLNY
    DLNDRAKVYTDFIWEKEGPKGDVTRNRTVAVGFGYKLHKQVETFVEAAWGREKDSDGVTTKNNVVGTGLR
    VHF
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : rOmpH was used in a mice protection study. Mice immunized and challenged intraperitoneally resulted 100% protection against P. multocida whilst mice immunized subcutaneously and challenged intraperitoneally only resulted 80% protection (Tan et al., 2010).
  • Related Vaccine(s): P. multocida rOmpH Vaccine
4. ompH
  • Gene Name : ompH
  • Sequence Strain (Species/Organism) : Pasteurella multocida strain Pm-17
  • NCBI Nucleotide GI : 99083557
  • NCBI Protein GI : 99083558
  • Protein Accession : ABF66676.1
  • Taxonomy ID : 747
  • Gene Strand (Orientation) : ?
  • Protein Name : outer membrane protein
  • DNA Sequence : Show Sequence
    >gi|99083557|gb|DQ417897.1| Pasteurella multocida strain Pm-17 outer membrane protein (ompH) gene, complete cds
    ATGAAAAAGACAATCGTAGCATTAGCAGTCGCAGCAGTAGCAGCAACTTCAGCAAACGCAGCAACAGTTT
    ACAATCAAGACGGTACAAAAGTTGATGTAAACGGTTCTGTACGTTTACTTCTTAAAAAAGAAAAAGATAT
    GCGTGGTGATTTAATTGATAACGGTTCACGCGTTTCTTTCAAAGCATCTCATGACTTAGGTGAAGGCTTA
    AGCGTATTAGGTTATGCAGAACTTCGTTTTAGTAAAGATGTGAAAGATAAAGAGGGTAAAGTTAACCAAC
    CAATCGGTAACGAAGTTCATGCTAAACGTCTTTATGCGGGTTTTGCGTATGAAGGTTTAGGTACATTAAC
    TTTTGGTAACCAATTAACAATTGGTGATGATGTTGGTGTGTCTGATTACACTTATTTTAACAGTGGTATC
    AATGGCGTACTTATTACTAGTGGTCAAAAAGCAATTAACTTCAAATCAGCAGAGTTCAACGGTTTCACAT
    TTGGTGGTGCGTATGTGTTCTCAGGCGATGCAAACAAAGATGCATTACGTGATGGTCGCGGTTTCGTAGT
    AGCAGGTTTATACAACAGACAAATCGGTGATGTTGGTTTTGCATTCGAAGCAGGCTATAGCCAAAAATAT
    GTAAAACAGAAAGTTGAACAACCTCAGCCTTTACCTCCTGGTCAAGTAGAGCGTTTCAAAGATGAAAAAG
    AAAAAGCTTTCTTGGTCGGTGCAGAATTATCGTACGCTGGTTTAGCGCTTGGTGTTGACTACGCACAATC
    TAAAGTGACTAACGTAGATGGTAAAAAACGTGCACTTGAAGTGGGTTTAAACTATGACCTTAATGATAAA
    GCGAAAGTTTATACAGACTTCATCTGGGAAAAAGAAGGTCCTAAAGGTGATGTTGAAAGAACTCGCACTG
    TAGCTGTAGGTTTTGGTTACAAACTTCACAAACAAGTTGAAACCTTTGTTGAAGGTGCTTGGGGAAGAAC
    AAAAGATGCAGATGGTAAAACAACAAAAGATAATGTAGTTGGTACAGGTTTACGCGTACACTTCTAA
  • Molecule Role : Protective antigen
  • Related Vaccine(s): P. multocida DNA vaccine pcDNA-OMPH + pcDNA-OMPA , P. multocida DNA vaccine pcDNA-OMPH/OMPA
1. IgG
  • Gene Name : IgG
  • Sequence Strain (Species/Organism) : Bos taurus
  • NCBI Gene ID : 281766
  • NCBI Protein GI : 116686102
  • Locus Tag : BOS_2620
  • Genbank Accession : GJ060600
  • Protein Accession : NP_001070870
  • Taxonomy ID : 9913
  • Chromosome No : 3
  • Gene Starting Position : 7996510
  • Gene Ending Position : 8005231
  • Gene Strand (Orientation) : +
  • Protein Name : transcript variant 2
  • Protein pI : 8.71
  • Protein Weight : 25616
  • Protein Length : 250
  • Protein Note : Also known as CD16; FCGR3; FCGR3@
  • DNA Sequence : Show Sequence
    >gi|258513364:7996510-8005231 Bos taurus breed Hereford chromosome 3, Bos_taurus_UMD_3.1, whole genome shotgun sequence
    CACTCTAACACACAGCATGTGGCAACTGCTACCACCGGCAGCTCTGCTGCTTCTAGGTAAGTCAGACTCA
    CTTGGCCTGAGAGCAGAGCAAAGATGCCCTGGGCACAGCAGGCATCTCTTCTCAGGCAAGGAATGAGACC
    CTTAACCAAGGACAGACCCCTTCCTATGTCTATAGACCTTGGTTTAGCTCCTAGGACACAGCTTCAGGGG
    TTAGAGATACAGGAAATGGGCATAATCGGGAGGTGAAAGGAGAGGACGTGAGTTCTCCGTCACTTCACTC
    CTCTAGGTCTCAGCTTCTCTGGCTATAAACTGACAAGTATGCACTGGGTAGCCCCTAAGGTCTGTCTCCC
    ATTCTCACTTTCCAATGCTCCTCTCTCAGTCGTTTCATTTCTATCCTTTCCAGAGGACTTGGGTGGAGAT
    AGTTTCCATGGCTTGATTCAGAGATATTCAACCTGTGCCCTTAACTTTGGGGTTTGAACAGGGACCAAGG
    AGGAAGGGTATTGAAAACAGGGATTTGGGCAGACAACAGATTAGGAGGTACAGACGCTGGAAACCAGAAG
    GCAGGCAGTGGGGGAGATACCCACTCTATTCATCTTTGTTGAAGATGTCTTTACCTTGTTTGTTTATTTA
    ATGGCTATACGGGGCCTTCACTGTGGCGCTCAGGCTCTTCATCGCTTTGCGCGGGCTGCCTCTAGTGGCG
    GAGCACAAGCCTCTTGTCGCGGTGGTCTCTCGTCGCGGTGGTCTCTCTTGTTGTGGAGCACAGGCTCTAG
    GGTGCTCAGGCTTCAGTAGTTGTGGCTCATGGGCTCTAGAACATGAGCTCTGGTTGCTCTGCAGTGTGTG
    GGATCTTACTTCTGGCGCCAGGGATTGAACCTGCGTCCCCTTTACTGGCAGGCGGATTCTTACCACCAGG
    GAAGTCCCCACTATCTTTATCCTGATTCTTGGGAACACTGGCCTCTGAGGGCAGAGGTGGGCAGGGGAGT
    TTAAATACCACACTCCAGTCACCCTGTTCTCTGCTGCTGACCAATATTTGTTTTATTCTTTTTTTCTTAC
    AGTTTCAGCTGACACGCAAACTGGTGAGTTTGCTTCATGGTCTTGGACGGATCGAGTGAGGCATGTAAAT
    GTGTAATAGCTGCAGGGCACTGTTAGGAAATGTTCTTTGCACAAGAAACTGTTGACATGGAGTTGATGGT
    GGTGGTGGTGGTGGTTTAGTCGCTAAGTTTTGTCTGACTTGCAACCCCATGGACTATAGCCTTCCAGGCT
    CCTCTGTCCATGGGATTCTCCAGGCAAAATATTGGAGTGGATTGCCATTTCCTTCTCCAGAGGATCTTCC
    CGACCCAGGGATTGAAACCAGGTCTCTTGCATTGCGGGCAGATTCTTGGCAGGGGCAATTCCCCCAATAC
    AGTGGGCTTGGCCCTACCAAGGAGGAGGCTAAGTCTCTCCAAGTCAGTATGCTCAGACTGAGTGCAATGC
    TGCTGCTGCTGCTGCTGCTGCTGCTAAGTCACTTCAGTCGTGTCCGACTCTGTGCGACCCCACAGACGGC
    AGCCCACCAGGCTCCGCCGTCCCTGGGATTCTCCAGGCAAGAACAGTGGAGTGGGTTGCCATTTCCTTCT
    CCAATGCGTGAAAGTAAAGTCGCTCAGTCGTGTCCAACTCTTAGCGACCCCATGGACTGCAGCCTACCAG
    GCTCCTCCATCCATGGGATTTTCCAGGCAAGAGTACTGGAGTGGGTTGTCATTGCGTTCTCCAGACTGAG
    TGCAATACTAAGGCTGAAATGCCAACTCTCAGTTTGCAATGGGTTTTGAGCCTCCTTGGGAATACCAGTA
    TAGAGCCTGCTCACTTCTCTGCCCTTATCTACATTCTCTTAACACTTCAGCAGATCCCTCAAAGGCTGTG
    GTGCTCCTAGACCCTCAGTGGAACCACGTGCTCACGAATGACCGTGTGACTCTGAAGTGCCAGGGAGACT
    ACCCTGTTGAAGACAATTCCACAAAGTGGTGGCACAATGGGACTCTCATCTCAAGCCAGACCCCCAGCTA
    CTTCATCGCAGATGTCAAGGTTCAGGACAGTGGCGAGTACAAGTGTCAGACAGGCCTCTCTGCACCCAGT
    GACCCGGTGAAGCTAGAAGTCCACGTAGGTGAGTAGGAGAAGGGGAAAAAGGAACTGACCAATAAAGGAT
    AAAAAAAAAAAGAGGCCCTGAAAAAAAATAATGTTCCTGGGGATTAAAACTAGGATGAGATGATCTGTAG
    TCTATTGAATTACATCAGTATTGTAGTCCTAGCTCCAAGTAGGCCTTAGATAAAATGTCAAAGCCTGGCA
    TACACTAGGGACAGGGCTGCTGGACTGCACAATTCCAAGAATCTACATTCACATAGAAGATGAATATATA
    CAGCATGAATGGTGTCATCTGAAGGTCAGGGCATGACATCAATGCTCTATAACAGTTATTGAATAAATTA
    ATGAATCCACTTTAGGACCTCAATCTCCTCATTCTCAGACACAATCTCCACATTCTCTAAGCTACCCAAC
    AAGCCACCCCTAATCTAGCATCATATCTATTTCCTCTTCCCATCAACGCTACACTCAAATATACACTTCA
    GCCTAAATTTGGCAATGTGAAATCTCTCCTAATAGAGATAGATACACGTTCAGCCCGCACATTCATCATG
    GAACGAAAGTCTTTGTATCTTAACAAAATCCAGGCATTGGATGCAAGGAGAAGTATGTTGAGGCAGAGAT
    CTCTCCTGGTGTCCCTGAAATCACACCACATAGCCTGGTACCTGCTGTGTCTTGTAAGCTTCACTCTATT
    TGCATGACTGCCCCATCTCCATAATGTATGTGAGTGGAACAAGCCTGGAGGGAAAGGCGGGTTTAATGAA
    GGAGGACCTGCAACAAAATTCCACGGACCTGGGTCTCTGAAGCTGATTTTCTGGGCTCCTACACCTGACT
    GTGTTACTTAGTTGACTTAGTTCTCAGTCTAGCTAGGTGAGAGATGGCCATGCCTGTGTGCCAAGTTGCT
    TCAGTCATATCCGACTCTTTGTGACCCTATGGACTGTAGCCTGCCAGGCTCCTCTGTCCATGGGATTCTC
    CAGGCAAGAATACTGGAGTGGATGGCCATGTCTTCCTCCAGGGGATCTTCCCAACCCAGGGATCTAAGCC
    ACATCTCTTACATCTCGTGCTTTGGCAGGCAGGTTCTTTACCACTAGCACCACCTGGGAATCCCAAGAGA
    TGGCCACCTGTGACCAAATAAAATGGGGAATTACCAACAGGAAGCAAGAGAAACCTCAAGTCTTGGAGTT
    GTTAGTTTGTCTTAAACTTGGCTCTAGAAACTGACTTTAGAAGTCTAATTAGTGTGAACAGTTTTAAACT
    CTGACCAAGAGCATTAAGTTCACCAGGCAAACTCCTGATCCTTCTTTTGGACCCACTTCACTTATCTTCT
    TCTCTGAGAAGCTTTGCTTACTTTCTTCGGGCCGGATTTCTTTGCTCCATTCTCTTTGGTCATGCAGTCC
    TTTGTTCTTAGCCTGTTGTAGCACTTATCACCTGGTATTATAATTATTTCTGAGTATATGTGTTTCTACG
    CCTAGACCACAGGTTCTTTGATGTGTCTCAGTCATCTGGGTGTCCCCAATCTGCATGACATGACATAGTA
    AGTTCTCAATAAGATATTTGTTTAACTAATGTATATATGAACATTCACTGAGTCCATGACACCCTGAATG
    GAATAAGAACGTTCTCCCCTCAAAGAAACCAAACTATATGTGTGTGTGTGTGTGTGTGCGTATATGTGTG
    TATATACAACATAAGTTATGTATATATATGTGTGTGTGTATGTATGTATATATATGATTACATATGTAAC
    CCCTGTTAATATTTAAGCACATGTTCTTTCTTTTTTTATGAGCATACATATGTTTTATATTCTTTTTAAC
    TTAACATTCTCTGATAAATGTTTTCTCATGTCATTTTAAAATTTCTCTGCAGTATCGTTTTAAATTATTC
    AGGCCAACTTCCTCACCATGACTTCAAGTTCTCTGTGTGTGTGAAGTCTGGTTACTTGGCAAGGCAGTTG
    TGAAAAGAGTTGTTTTGATGATTAACTGTTTCCGTCTTAAAGGCTGTGCTCTGTAATGAAATGGTCTTGC
    TAAGACACTGTGGCCCCTGAAATTAGCAGTTACCATCAGCACTACCAAGCATGCTTTTCTTTCCTCTCCC
    TGACTTTTACAAGGAGTTCTCCTTCACAATTTCTGTAGCCACTCCTACGGATACTCAGTAACCTTCTTCC
    TGACTGGTTGCAACAGTCTTCCAACATTCCTAAAACCGTCTATTCCTTCTGAAGTCTACCTTTCCTTGTA
    TTCTAATATGATTCTTACTCTTTGATCTAGAATTTACAATGGCCCCTTATCACCTTCCATAGCAAATCCA
    AGTGTGGACTTTGAGGATGCTGCAGCTTGCTTCTCACCTGCCTCATCACTTAGTCCTTCTGCTCTCACTT
    TATGCTTTGATCATGTGTGTGTCTGTCCCTCTCTCCCATTAGACAAAAGCTCTTGGAGTGACTTGAGTTC
    TCATCCAGAGTCCAGTTGTCTTTTTCCCAAAGAAAGTTACATAAGGACGGCGCCGCCCGGTCTGGAGTTC
    CACTGTCCCCCAGCACCTGGGTGGTGAGCATTCTCTTCAGAAGAGCTTTGTGCTGGGTGCTGAGGCCTCC
    TGGGCCTGTGTTCTCTTTGTGTTTTGCAGGCTGGCTATTGCTCCAGGTCGCTCAACGGGTGGTAAATGTG
    GGAAAGCCCATTCGGCTGAAGTGTCACAGCTGGAAGAAAACTCCTGTAGCAAAGGTCCAGTATTTCCGGA
    ATGGCAGAGGCAAGAAGTATTCTCATGGGAATTCTGACTTCCACATTCCAGAAGCAAAACTTGAACACAG
    TGGTTCCTACTTCTGCAGGGGCATTATCGGGTCTAAAAACGAGTCTTCAGAGTCTGTGCAGATCACTGTT
    CAAGGTAAGACATGTGCGGCACTAAAGGGACCAGAGACCCCTGTGCTGGGAATCTTGCATTCACACTGGG
    GAGATGAGTTGGGAGGAAATTGCTGACAATTCCACAGACTTCTTTACGAGTGTCATTCACTTTGAAACAT
    GACAGCAGGTGCAAAGGCCACATTTCCTTCCTCATAAATATGCCTGTCCTAACTTACCTCATTCAAACCA
    TATCCACACTCTTGTGTATCTCTATCGTGCTGGCCCTTTTTTTGCCTGCTCCTGCTCCCCTTTCTCTTCC
    AAGTCTCAAGTCTTAGCCAAGAGTCTAGCTGGCAGTAACCCCTCACTTTCTCACAGAAAGACCCAGAACC
    TGTGTTCTGGCTCTGCTGCTGATTAACCATATGACTGTGGCCAGTTAGTCTCTTGAACTCAATTTCCACT
    TTTGTAACAAAGACAAGCTGACGTTTATTGGGCATTTTTCAGTGTGCTGGACACTGTGCTGAATGCTTCA
    TTACATGCACTTAATCTGAACACCTGAGAATTAATGCTTTTGAGCTGAGGTGTTGGAAAAGACTCTTGAG
    AGCCCCTTGGACAGCAAGGACAGTCAATCCTAAAGGAAATCAGTCCTGAATATTCATTGGAAGGACTGAT
    GCTGAAGCTGAAACTCCAATCCTTTGGCCACCTGATGAGAAGAACTGACTCATTGGAAAAGACCCTGATG
    CTGGGAAAGATTGAAGCAGAAGAAGAAGGGATGACAGAGGATGAGATGATTGGATGGCCTCACCGACTCA
    ATGGCCATGAGTTTGAGTGAGCTCTGGGAGTTGGTGATGGACAGGGAAGCCTGGCGTGTTGTAGTCCATG
    GGGTCACAAAGAGTCGGACACGACTGAGTGACTGAACTGAACTGATATTGAATTCCACTTTCCAAATCAT
    TTAGAAAACATCTCCAGTTTCTGTAGCACCATCCTCCAGGGTCAGAGATGCCCTGCCATGGTGCTCCTGG
    ACTTCCTAATCTCCCAAAACTTCCACCTGGAATCAGACTGAGATAAAAACCCTGATACTGGGAAAGATTG
    AGGGCAGGAAGAGAAGGGGGCGACAGAGGATGAGATGGTTGGATAGTGTCATTGACTAAACGGACATGAG
    TTTGAGCAAACTCTGAGAGATAGTGGAGGACAGTTAAGCCTGGCATGCTGCAGTCCATGGGGTCACCAAG
    ATTCGACACGACTGAGTGACTGAACAACAATACACTGTAAGCAATTTACATGTAATAATACAGCAATATA
    GACACACATCTTCTGAGATTCTAACAAAACAATGCCATAGTTTGTATAAAAAATAACTTCATCACAATTT
    AAATTGAAAGTAAATACTCTCAAATAGCTAGGAAAAGAGAGAGCAAATAATAAGGAAAATGGGGGCAAAT
    TGCAAACAATTAGTAAATCTAGGTAAAGAATATCTGAGAGTTATTTGTACTTTATTGACATCCATTTTTT
    AAGTTCAAAATTATATCAAAATTAAGATTTTTTAAATTGAGACTAAAAATGCACTCTCATCTTACTACCT
    TATAGGCAACAGCAGAGAATGACTTTAAAACAATCTTAATGGCTAAGAGGTTGAGAAGCAACAAATTCTA
    GCCCTTTCCATTTTGGGTTCTTAGTTACTGAGCCTTGATAAAGAAATATTTTCTGACGATAAATAGGATA
    AGTAGTAGATTTCAACGGCTTACCTTGTGTGTGTGTTGGTTTTTGTTTTTGTTTTTTCATTTTCTTGAGT
    CGGGTGAATACAATGAGTATAATTTTGAGACACAAGAGAAAGTTACTGAATTAAAAAACAGTGTTCTCAC
    AACAACTTAAACTTTGATATCTCTCATTGCTGTTGTACAGTCACTAAGTCATGTCCGACTTTTTGCAGCC
    CCATAGACAGCATGCCAGGCTTCCCTGTCCTTACCTAACTCCCAAGTTTGCTCAAACTCATGTCTATTGA
    GTTAGACATCTCATCCTCTGTCACCTCCTTCTCCTTCGCATCAGGTGGCCAAAGTATTGGAGCTTCAGCT
    TCAGCATCAGTCCTTCCAATGAATATTCAGGGTTGATGATCTCACGCAAAACCCAGCTACAAGTACCTCC
    ATCAAACATGAAAACACTATTGCTCAAGAAGCACTAGAATCCAAAACTGGTAGGAGGAAGCTGTGGCTTT
    CTTCCAGACTCCCCCACATTCAATAGAATCTGTTTCTTAGCAGGTGTCAGAAAGACTTCACAGTGATGAC
    CTCACTGTTTATGCCAATTTTCTGCCTTAACAAATGTCATTTTTTTCTCATCTCTCTGCTCAGCTCCAGA
    AACTTTACAAACTGTCTCGTCATTCTTTCTACCTTGGCACCAGATCACCTTCTGTCTGGTGATGGGAGTC
    CTGTTTGCAGTGGACACGGGACTGTATTTTTCTGTACGGAGACACCTTCAAAGCTCAGAGGAATGGAGGG
    ATGGCAAAGTCACATGGAGCAAGGGCCCTTAGGACAAATGGAGGTAATGAAAGCAGCATCCCCATCCCAT
    GGGGTGATAAAAGCAGCATCTATGAACCTCTTCCTAATTTCACAGCCTTATCATCTCCCAACAGGCATCT
    CTGGGAGCAGCAGGAAAATTACACGTCAGACTCTAGGGATCTGAGGATCCTTCACCCAACTCTGTTTCTT
    CTAGTCTCCTATGGAAAGAAAGTGCCAACCGTGAAGGACCAGTAAATATCTGCATCACCAGAAATAGAAG
    TCTCAGAGCTACGTGGCTGCTTTCTGTATTCCAACCATTCTGTCCCAAGAGAACAACCATACAGACTCTC
    AAAGATCAGCCCTGATGTATGAATATTGTGCTAAAATAAATGGATATGTAAAGAAGAAAATTCATGGTGG
    AGAGGCAGCTGGATGGTGGTCTACATCTTTTGCTGCACGCTGACTGCCTTCAAGGCACCCTGAAACTCCT
    TCTAGATAGTCTGTGGGTACATGTGGGGGTGTAGGGAACAGAGCACAACCATTGAAGAGGGTGGCTGAGA
    AAGAGCAGGGTAGTCCAGGATAGACCAGACAAGACCACCACCTGGGCTGTCTTCCTAGAACATGAACCAT
    GGTGGAGGTAAAAGAAAATCACAGACGTGAGATGGGATTGAGTTTTCCAGGGGAGCCCCTGTCAAAAGGA
    TACAGTGTGAGTCTGTGAGTATACAATGATAAATCCTCTCAATGTCATGAGTAGAAAATGATCCAGGAAG
    GGGGTTAGGGGTTGGAGGATTTGCAAAAGAAAGCACAGAATAAACTCATTGGAAGGAACATTGCTATCCC
    AAATTAAGCCCACTGAACAAAGGTATATCAGTGTCTAAACCGAGAAAGCATTACAAGAAAAAGTCAACCA
    CAACTGCACAGGAAGGAGCTGGCAGGAGATGAGGATGCTTTTAGACTGAGAATTAGAGAGAAGGGGCATA
    TAAAACCAGAATTTTCACTTCAATATCTAATTCAGCTTTATTCACATCACCCTTAAACAAATGTTGGATA
    ACCACTATTAAATGTACTAAACTCTACTGAATTAAATCATGAAACTTTTAAATCCTTCAGCATGTCAATA
    ATAATGGAGTAGAGGTGAAATCAATCACTGCTTCTGGAAGAAAGCTTTAGCTATCTCTCTTTGTGTTTTA
    GAAGCTTTAAACTGAACATTTCTTGATTCCGGTAAGGCATTTTTACAAGATTCTGCATGTTATTGTTAGA
    TAGAAGATGGAAAAACCACGATAATAAAACATGAATGATAGA
  • Protein Sequence : Show Sequence
    >gi|116686102|ref|NP_001070870.1| low affinity immunoglobulin gamma Fc region receptor III isoform 1 precursor [Bos taurus]
    MWQLLPPAALLLLVSADTQTADPSKAVVLLDPQWNHVLTNDRVTLKCQGDYPVEDNSTKWWHNGTLISSQ
    TPSYFIADVKVQDSGEYKCQTGLSAPSDPVKLEVHVGWLLLQVAQRVVNVGKPIRLKCHSWKKTPVAKVQ
    YFRNGRGKKYSHGNSDFHIPEAKLEHSGSYFCRGIIGSKNESSESVQITVQAPETLQTVSSFFLPWHQIT
    FCLVMGVLFAVDTGLYFSVRRHLQSSEEWRDGKVTWSKGP
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): Pasteurella multocida aroA mutant vaccine
2. IgM
  • Gene Name : IgM
  • Sequence Strain (Species/Organism) : Bos taurus
  • NCBI Gene ID : 444875
  • Locus Tag : BOS_20600
  • Genbank Accession : GJ062732
  • Taxonomy ID : 9913
  • Chromosome No : 21
  • Gene Starting Position : 71507508
  • Gene Ending Position : 71508717
  • Gene Strand (Orientation) : +
  • Protein Name : IgM
  • DNA Sequence : Show Sequence
    >gi|258513346:71507508-71508717 Bos taurus breed Hereford chromosome 21, Bos_taurus_UMD_3.1, whole genome shotgun sequence
    AGTGACTTCTGGGAGTGGTGACTCTCATCTGCTCGAAGATGAACCCACTGTGGACCCTCCTCTTTGTGCT
    GTCAGCCCCCAGAGGTGAGTGTCTCTGGGTCAGACATGGGCACGTGGGGAAGCTGCCTCTGAGCCCACGG
    GTCACCGTGCTTCTCTCTCTCCACAGGGGTCCTGTCCCAGGTGCAGCTGCGGGAGTCGGGCCCCAGCCTG
    GTGAAGCCCTCACAGACCCTCTCCCTCACCTGCACGGTCTCTGGATTCTCATTAAGCGATAATAGTGTAG
    GCTGGGTCCGCCAGGCTCCAGGAAAGGCGCTGGAGTGGCTCGGTGTCATATATAGTGGTGGAAGCACAGG
    CTATAACCCAGCCCTGAAATCCCGGCTCAGCATCACCAAGGACAACTCCAAGAGCCAAGTCTCTCTATCA
    CTGAGCAGCGTGACAACTGAGGACACGGCCACATACTACTGTGCAAGAGACACAGTGAGGGGAAGTCAGT
    GTGAGCCCAGACAAAAACCTCCCTGCACAGGGGCCCGTGACCACGAGGGGGCGCTCAGGACTCAGTACAG
    AGCTGAGTCCTGGAGCAGGTACGGAAGAGGCGTTGGGCGGTGGGGGTCCCGGGGGGGATTCTCCTCAGAG
    CTTCTCTTTGCTCCTCCTGCCCAGGAGCTGCAGCATAGACCCATTTCTGTGTTCTGGTATTTCATTGTTG
    TGGTTTATGTTACTCTCAGACAACTGTGTGTATATATATATTTCATTTTATCTTGAAGCAAGGATAGCTT
    TAGGAAAACATACAGTCACACATAATACTCAACAGCTAAATTTTTTCTCCTTCATTTTTATTCCTTCAAG
    GGAACTCAGTAAAACACTTGCTGCTGATACTGCTAAGTCGCTTCAGTTGTGTCCGACTCTGTGTGACCCC
    ATAGATGCCAGCCCATTAGGCCCCACGGTCCCTGGGATTCTCCAGGCAAGAACACTGGAGTGGGTTGCCA
    TTTCGTTCTCCAATGCATGAAAGTGAAAAGTGAAAGTGAAGTCGCTCAGTCCTGTCCAACTCTTCACGAC
    TCCATGGACTGCAGCCTACCAGGCTCCTCCGTCCATGGGATTTTCCAGGCAAGAGTACTGGAGTGGGGTG
    CCATTGCCTCCTCCGTCAGTAAAACCCTTGACTCTCGATAATTTCAAAACTGTTAACTATCCTGAAAGGA
    AACATAAGATATTTAAACAT
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): Pasteurella multocida aroA mutant vaccine
IV. Vaccine Information
1. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.20)
a. Manufacturer:
Texas Vet Lab, Inc.
b. Vaccine Ontology ID:
VO_0001877
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
2. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.21)
a. Manufacturer:
Texas Vet Lab, Inc.
b. Vaccine Ontology ID:
VO_0001878
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
3. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 4109.20)
a. Manufacturer:
Texas Vet Lab, Inc.
b. Vaccine Ontology ID:
VO_0001879
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
4. Bovine Rhinotracheitis-Parainfluenza 3 Killed Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin (USDA: 4265.00)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0001885
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
5. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 43S5.20)
a. Manufacturer:
Texas Vet Lab, Inc.
b. Vaccine Ontology ID:
VO_0001905
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
6. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 43T5.20)
a. Manufacturer:
Texas Vet Lab, Inc.
b. Vaccine Ontology ID:
VO_0001906
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
7. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002006
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
8. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.21)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002007
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
9. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus-Mannheimia Haemolytica-Pasteurella Multocida Modified Live Virus, Avirulent Live Culture Vaccine (USDA: 11A8.22)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002008
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
10. Bovine Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 4C95.20)
a. Manufacturer:
Texas Vet Lab, Inc.
b. Vaccine Ontology ID:
VO_0002024
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
11. Mannheimia Haemolytica-Pasteurella Multocida Avirulent Live Culture Vaccine (USDA: 1861.01)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002029
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
12. P. multocida DNA vaccine pcDNA-OMPH + pcDNA-OMPA
a. Vaccine Ontology ID:
VO_0004536
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Chickens
e. Gene Engineering of OmpA
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Gene Engineering of ompH
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Vector:
pcDNA3.1(+) (Gong et al., 2013)
h. Immunization Route
Intramuscular injection (i.m.)
i. Chicken Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: A significant increase in serum antibody levels was observed in chickens vaccinated with divalent combination. Additionally, the lymphocyte proliferation (SI value) and the levels of IFN-γ were both higher in chickens immunized with divalent combination than in those vaccinated with monovalent DNA vaccines (P<0.05) (Gong et al., 2013).
  • Efficacy: The protection provided by divalent combination vaccine was superior to that provided by monovalent DNA vaccines after challenging with the avian P. multocida strain CVCC474 (Gong et al., 2013).
13. P. multocida DNA vaccine pcDNA-OMPH/OMPA
a. Vaccine Ontology ID:
VO_0004537
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Chickens
e. Gene Engineering of OmpA
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Gene Engineering of ompH
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Vector:
pcDNA3.1(+) (Gong et al., 2013)
h. Immunization Route
Intramuscular injection (i.m.)
i. Chicken Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: A significant increase in serum antibody levels was observed in chickens vaccinated with the fusion DNA vaccine. Additionally, the lymphocyte proliferation (SI value) and the levels of IFN-γ were both higher in chickens immunized with the fusion DNA vaccine than in those vaccinated with monovalent DNA vaccines (P<0.05) (Gong et al., 2013).
  • Efficacy: Protection provided by the fusion DNA vaccine was superior to that provided by monovalent DNA vaccines after challenging with the avian P. multocida strain CVCC474. The protective efficacy in chickens immunized three times with the fusion DNA vaccine was equivalent to the protective efficacy in chickens vaccinated once with the attenuated live vaccine (Gong et al., 2013).
14. P. multocida rOmpH Vaccine
a. Vaccine Ontology ID:
VO_0004221
b. Type:
Subunit vaccine
c. Status:
Research
d. Antigen
100μg of rOmpH (Tan et al., 2010).
e. Gene Engineering of ompH
  • Type: Recombinant protein preparation
  • Description: The P. multocida ompH gene was cloned into E. coli and then extracted and purified to result in rOmpH (Tan et al., 2010).
  • Detailed Gene Information: Click here.
f. Adjuvant: Freunds emulsified oil adjuvant
  • VO ID: VO_0000133
  • Description: Freund's adjuvant
g. Immunization Route
subcutaneous injection
15. Pasteurella multocida aroA mutant vaccine
a. Vaccine Ontology ID:
VO_0002862
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Cow
e. Gene Engineering of aroA
f. Immunization Route
Intramuscular injection (i.m.)
g. Cattle Response
  • Persistence: An aroA mutant is highly attenuated in calves (Dagleish et al., 2007).
  • Efficacy: An aroA mutant induces significant protection in calves from challenge with wild type Pasteurella multocida (Dagleish et al., 2007).
  • Host Gene Response of IgG
    • Gene Response: After second vaccination, serum IgG titers rose. Groups receiving 109 and 108 CFU of the mutant had significantly higher titer of IgG than those receiving 107 CFU, and all vaccinated groups had significantly higher titers than the unvaccinated challenge control group of calves (Dagleish et al., 2007).
    • Detailed Gene Information: Click here.
  • Host Gene Response of IgM
    • Gene Response: After the second vaccination, serum IgM titers rose. Groups receiving 109 and 108 CFU of the mutant had significantly higher titer of IgM than those receiving 107 CFU, and all vaccinated groups had significantly higher titers than the unvaccinated challenge control group of calves (Dagleish et al., 2007).
    • Detailed Gene Information: Click here.
16. Pasteurella Multocida Avirulent Live Culture, Avian Isolate Vaccine (USDA: 1871.01)
a. Manufacturer:
Biomune Company
b. Vaccine Ontology ID:
VO_0001722
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
17. Pasteurella Multocida Avirulent Live Culture, Avian Isolate Vaccine (USDA: 1871.02)
a. Manufacturer:
Lohmann Animal Health International, Arko Laboratories Ltd., Biomune Company
b. Vaccine Ontology ID:
VO_0001723
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
18. Pasteurella Multocida Avirulent Live Culture, Avian Isolate Vaccine (USDA: 1871.03)
a. Manufacturer:
Intervet Inc., Arko Laboratories Ltd., Biomune Company
b. Vaccine Ontology ID:
VO_0001724
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
19. Pasteurella Multocida Avirulent Live Culture, Avian Isolate Vaccine (USDA: 1871.04)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001725
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
20. Pasteurella Multocida Avirulent Live Culture, Avian Isolate Vaccine (USDA: 1871.05)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001726
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
21. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Bordetella Bronchiseptica-Clostridium Perfringens Type C-Erysipelothrix Rhusiopathiae-Escherichia Coli-Pasteurella Multocida Bacterin-Toxoid (USDA: 49T9.21)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002319
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
V. References
1. Dagleish et al., 2007: Dagleish MP, Hodgson JC, Ataei S, Finucane A, Finlayson J, Sales J, Parton R, Coote JG. Safety and protective efficacy of intramuscular vaccination with a live aroA derivative of Pasteurella multocida B:2 against experimental hemorrhagic septicemia in calves. Infection and immunity. 2007; 75(12); 5837-5844. [PubMed: 17875632].
2. Gong et al., 2013: Gong Q, Qu N, Niu M, Qin C, Cheng M, Sun X, Zhang A. Immune responses and protective efficacy of a novel DNA vaccine encoding outer membrane protein of avian Pasteurella multocida. Veterinary immunology and immunopathology. 2013; 152(3-4); 317-324. [PubMed: 23340446].
3. Harper et al., 2006: Harper M, Boyce JD, Adler B. Pasteurella multocida pathogenesis: 125 years after Pasteur. FEMS microbiology letters. 2006; 265(1); 1-10. [PubMed: 17107417].
4. Tan et al., 2010: Tan HY, Nagoor NH, Sekaran SD. Cloning, expression and protective capacity of 37 kDa outer membrane protein gene (ompH) of Pasteurella multocida serotype B:2. Tropical biomedicine. 2010; 27(3); 430-441. [PubMed: 21399583].
5. Wiki: P. multocida: Wiki: Pasteurella multocida [http://en.wikipedia.org/wiki/Pasteurella_multocida]