VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Feline infectious peritonitis virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. 3a (Virmugen)
    2. 3b (Virmugen)
    3. 3c (Virmugen)
    4. 7a (Virmugen)
    5. 7b (Virmugen)
  3. Vaccine Information
    1. Feline infectiour peritonitis virus 3abc mutant vaccine
    2. Feline Infectious Peritonitis Modified Live Virus Vaccine (USDA: 15A1.20)
    3. Feline infectious peritonitis virus 7ab mutant vaccine
  4. References
I. General Information
1. NCBI Taxonomy ID:
11135
2. Disease:
Feline infectious peritonitis (FIP)
3. Introduction
Feline infectious peritonitis virus (FIPV) is a feline coronavirus that causes feline infectious peritonitis. Infection is ubiquitous in domestic cats, especially where conditions are crowded. FIPV can survive in for 7 weeks in a dry environment and may be transmitted indirectly via fomites. FPIV is an enveloped single stranded RNA virus. Most FIPV-infected cats either stay healthy or show only a mild enteritis. Only a proportion of FPIV-infected cats will develop FIP, a pyogranulomatous
vasculitis (Addie et al., 2009).
4. Microbial Pathogenesis
The pathogenesis of FIP may be explained by an increased number of mutants, stochastically arising during bursts of replication (eg, under immune suppression), some of them growing to high concentrations in monocytes and macrophages. Mutations have been identified in non-structural genes, and more may remain to be identified. These highly virulent FPIV mutants have consistently induced FIP under experimental conditions, but their virulence has not been traced to a molecular source. The viral load and the cat’s immune response determine whether FIP will develop. Both viral genetics and host immunity are likely to play a role in the development of FIP. The pathology of FIP has been classified into two forms: an effusive (wet) FIP characterised by polyserositis (eg, thoracic and abdominal effusion)and vasculitis, and a non-effusive (dry) FIP characterised by granulomatous lesions in organs (Addie et al., 2009).
5. Host Ranges and Animal Models
Domestic cats
6. Host Protective Immunity
It has been suggested that cats mounting a strong cell-mediated immune response do not develop FIP, whereas cats showing a predominantly humoral response progress to disease. Hypergammaglobulinaemia is common in cats with FIP. Also, a drastic depletion of T cells from blood and lymphoid tissues has been described (Addie et al., 2009).
1. 3a
  • Gene Name : 3a
  • Sequence Strain (Species/Organism) : Feline infectious peritonitis virus
  • NCBI Gene ID : 10040181
  • NCBI Protein GI : 315192965
  • Locus Tag : FIPV_gp03
  • Genbank Accession : AY994055
  • Protein Accession : YP_004070195
  • Taxonomy ID : 11135
  • Gene Starting Position : 24860
  • Gene Ending Position : 25075
  • Gene Strand (Orientation) : ?
  • Protein Name : putative 3a protein
  • Protein pI : 4.49
  • Protein Weight : 6974.53
  • Protein Length : 71
  • DNA Sequence : Show Sequence
    >gi|315192962:24860-25075 Feline infectious peritonitis virus, complete genome
    TATGGACATTGTCAAATCTATTGACATATTCGTAGACGCTGTACTTGACGAACTTGACCGTGCATACTTT
    GCTGTAACTCTTAAAGTAGAATTTAAGACTGGTAAACTACTTGTGTGTATAGGTTTTGGTGACACACTTC
    TTGAGGCTAAGGACAAAGCGTATGCTAAGCTTGGTCTCTCCTTTATTGAAGAAGTCAATAGTCATACAGT
    TGTTTA
  • Protein Sequence : Show Sequence
    >gi|315192965|ref|YP_004070195.1| putative 3a protein [Feline infectious peritonitis virus]
    MDIVKSIDIFVDAVLDELDRAYFAVTLKVEFKTGKLLVCIGFGDTLLEAKDKAYAKLGLSFIEEVNSHTV
    V
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A 3abc deletion mutant in Feline infectious peritonitis virus (FIPV) was attenuated and provided protection against virulent FIPV strain 79-1146 challenge in kittens (Haijema et al., 2004).
  • Related Vaccine(s): Feline infectiour peritonitis virus 3abc mutant vaccine
2. 3b
  • Gene Name : 3b
  • Sequence Strain (Species/Organism) : Feline infectious peritonitis virus
  • NCBI Gene ID : 10040182
  • NCBI Protein GI : 315192966
  • Locus Tag : FIPV_gp04
  • Genbank Accession : AY994055
  • Protein Accession : YP_004070196
  • Taxonomy ID : 11135
  • Gene Starting Position : 25020
  • Gene Ending Position : 25235
  • Gene Strand (Orientation) : ?
  • Protein Name : putative 3b protein
  • Protein pI : 11.43
  • Protein Weight : 7960.26
  • Protein Length : 71
  • DNA Sequence : Show Sequence
    >gi|315192962:25020-25235 Feline infectious peritonitis virus, complete genome
    TATGCTAAGCTTGGTCTCTCCTTTATTGAAGAAGTCAATAGTCATACAGTTGTTTAGTATTACTGTTTAC
    AAGTTTAAAGCCAAATTTTGGTATAAACTACCTTTTGAAACTAGACTTTGTATCATTAAACACACAAGAC
    CCAAAGCATTAAGTGTTACAAAACAAGTAAAGAGAGATTATAGAAAAATTGCCATTCTAAATTCCATGCG
    AAAATG
  • Protein Sequence : Show Sequence
    >gi|315192966|ref|YP_004070196.1| putative 3b protein [Feline infectious peritonitis virus]
    MLSLVSPLLKKSIVIQLFSITVYKFKAKFWYKLPFETRLCIIKHTRPKALSVTKQVKRDYRKIAILNSMR
    K
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A 3abc deletion mutant in Feline infectious peritonitis virus (FIPV) was attenuated and provided protection against virulent FIPV strain 79-1146 challenge in kittens (Haijema et al., 2004).
  • Related Vaccine(s): Feline infectiour peritonitis virus 3abc mutant vaccine
3. 3c
  • Gene Name : 3c
  • Sequence Strain (Species/Organism) : Feline infectious peritonitis virus
  • NCBI Gene ID : 10040183
  • Locus Tag : FIPV_gp05
  • Taxonomy ID : 11135
  • Gene Starting Position : 25232
  • Gene Ending Position : 25966
  • Gene Strand (Orientation) : ?
  • DNA Sequence : Show Sequence
    >gi|315192962:25232-25966 Feline infectious peritonitis virus, complete genome
    AATGATTGGTGGACTTTTTCTTAACACTCTTAGTTTTGTAATTGTTAGTAACCATGTTATTGTTAATAAC
    ACAGCAAATGTGCATACTACACAACATGAAAATGTTATAGTACAACAGCATTAGGTTGTTAGTGCTAGAA
    CACAAAATTATTACCCAGAGTTCAGCATCGCTGTACTCTTTGTATCATTTTTGGCTTTGTACCGTAGTAC
    AAACTTTAAGACGTGTGTCGGCATCTTAATGTTTAAGATTGTATCAATGACACTTGTAGGGCCTATGCTT
    ATAGCATATGGTTACTACATTGATGGCATTGTTACAATAACTGTCTTAGCTTTAAGATTTTTCTACTTAG
    CATACTTTTGGTATGTTAATAGTAGGTCCGAATTTATTTTATACAATACAACGACACTCATGTTTGTACA
    TGGCAGAGCTGCACCGTTTATGAGAAGTTCTCACAGCTCTATTTATGTCACATTGTATGGTGGCATAAAT
    TATATGTTTGTGAATGACCTCACGTTGCATTTTGTAGACCCTATGCTTGTAAGAATAGCAATACGTGGCT
    TAGCTCATGCTGATCTAACTGTTTTTAGAGCAGTTGAACTTCTCAATGGTGATTTTATATATGTATTTTC
    ACAGGAGCCCGTAGCCGGTGTTTACAATGCAGCCTCTTCTCAGGCGGTTCTAAACGAAATTGACTTAAAA
    GAAGAAGAAGAAGACCATAACTATGACGTTCCCTA
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A 3abc deletion mutant in Feline infectious peritonitis virus (FIPV) was attenuated and provided protection against virulent FIPV strain 79-1146 challenge in kittens (Haijema et al., 2004).
  • Related Vaccine(s): Feline infectiour peritonitis virus 3abc mutant vaccine
4. 7a
  • Gene Name : 7a
  • Sequence Strain (Species/Organism) : Feline infectious peritonitis virus
  • NCBI Gene ID : 10040187
  • NCBI Protein GI : 315192970
  • Locus Tag : FIPV_gp09
  • Genbank Accession : AY994055
  • Protein Accession : YP_004070200
  • Taxonomy ID : 11135
  • Gene Starting Position : 28151
  • Gene Ending Position : 28456
  • Gene Strand (Orientation) : ?
  • Protein Name : non-structural protein 7a
  • Protein pI : 8.52
  • Protein Weight : 9843.18
  • Protein Length : 101
  • DNA Sequence : Show Sequence
    >gi|315192962:28151-28456 Feline infectious peritonitis virus, complete genome
    CATGCTCGTTTTCGTCCATGCTGTACTTGTAACAGCTTTAATCTTACTACTAATTGGTAGAATCCAATTA
    CTAGAAAGGTTGTTACTCAGTCATCTGCTTAATCTTACAACAGTCAGTAATGTTTTAGGTGTGCCTGACA
    GTAGTCTGCGTGTAAATTGTTTGCAGCTTTTGAAACCAGACTGCCTTGATTTTAATATCTTACATAAAGT
    TTTAGCAGAAACCAGGTTACTAGTAGTAGTACTGCGAGTGATCTTTCTAGTTCTTCTAGGGTTTTCCTGC
    TATACATTGTTGGGTGCATTATTTTA
  • Protein Sequence : Show Sequence
    >gi|315192970|ref|YP_004070200.1| non-structural protein 7a [Feline infectious peritonitis virus]
    MLVFVHAVLVTALILLLIGRIQLLERLLLSHLLNLTTVSNVLGVPDSSLRVNCLQLLKPDCLDFNILHKV
    LAETRLLVVVLRVIFLVLLGFSCYTLLGALF
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A 7ab deletion mutant in Feline infectious peritonitis virus is attenuated and provides protection against virulent FIPV strain 79-1146 challenge in kittens (Haijema et al., 2004).
  • Related Vaccine(s): Feline infectious peritonitis virus 7ab mutant vaccine
5. 7b
  • Gene Name : 7b
  • Sequence Strain (Species/Organism) : Feline infectious peritonitis virus
  • NCBI Gene ID : 10040188
  • NCBI Protein GI : 315192971
  • Locus Tag : FIPV_gp10
  • Genbank Accession : AY994055
  • Protein Accession : YP_004070201
  • Taxonomy ID : 11135
  • Gene Starting Position : 28461
  • Gene Ending Position : 29081
  • Gene Strand (Orientation) : ?
  • Protein Name : non-structural protein 7b
  • Protein pI : 7.25
  • Protein Weight : 22221.54
  • Protein Length : 206
  • DNA Sequence : Show Sequence
    >gi|315192962:28461-29081 Feline infectious peritonitis virus, complete genome
    CATGATTGTTGTAATCCTTGTGTGTATCTTTTTGGCTAATGGAATTAAAGCTACTGCTGTGCAAAATGAC
    CTTCATGAACATCCCGTTCTTACCTGGGATTTATTACAGCATTTCATAGGACATACCCTCTACATTACAA
    CACACCAGGTCTTAGCACTACCGCTTGGATCTCGTGTTGAGTGTGAGGGTATCGAAGGTTTCAATTGCAC
    ATGGCCTGGCTTTCAAGATCCTGCACATGATCATATTGATTTCTACTTTGATCTTTCTAATCCTTTCTAT
    TCATTTGTAGATAATTTTTATATTGTAAGTGAGGGAAATCAAAGAATCAATCTCAGATTGGTTGGTGCTG
    TGCCAAAACAAAAGAGATTAAATGTTGGTTGTCATACATCATTTGCTGTTGATCTTCCATTTGGGATTCA
    GATATACCATGACAGGGATTTTCAACACCCTGTTGATGGCAGACATCTAGATTGTACTCACAGAGTGTAC
    TTTGTGAAGTACTGTCCACATAACCTGCATGGTTATTGCTTTAATGAGAGGCTGAAAGTTTATGACTTGA
    AGCAATTCAGAAGCAAGAAGGTCTTCGACAAAATCAACCAACATCATAAAACTGAGTTATA
  • Protein Sequence : Show Sequence
    >gi|315192971|ref|YP_004070201.1| non-structural protein 7b [Feline infectious peritonitis virus]
    MIVVILVCIFLANGIKATAVQNDLHEHPVLTWDLLQHFIGHTLYITTHQVLALPLGSRVECEGIEGFNCT
    WPGFQDPAHDHIDFYFDLSNPFYSFVDNFYIVSEGNQRINLRLVGAVPKQKRLNVGCHTSFAVDLPFGIQ
    IYHDRDFQHPVDGRHLDCTHRVYFVKYCPHNLHGYCFNERLKVYDLKQFRSKKVFDKINQHHKTEL
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A 7ab deletion mutant in Feline infectious peritonitis virus is attenuated and provides protection against virulent FIPV strain 79-1146 challenge in kittens (Haijema et al., 2004).
  • Related Vaccine(s): Feline infectious peritonitis virus 7ab mutant vaccine
III. Vaccine Information
1. Feline infectiour peritonitis virus 3abc mutant vaccine
a. Type:
Live, attenuated vaccine
b. Status:
Research
c. Host Species as Laboratory Animal Model:
Cat
d. Gene Engineering of 3a
  • Type: Gene mutation
  • Description: This 3abc mutant is from Feline infectious peritonitis virus (Haijema et al., 2004).
  • Detailed Gene Information: Click here.
e. Gene Engineering of 3b
  • Type: Gene mutation
  • Description: This 3abc mutant is from Feline infectious peritonitis virus (Haijema et al., 2004).
  • Detailed Gene Information: Click here.
f. Gene Engineering of 3c
  • Type: Gene mutation
  • Description: This 3abc mutant is from Feline infectious peritonitis virus (Haijema et al., 2004).
  • Detailed Gene Information: Click here.
g. Immunization Route
Oronasal immunization
h. Cat Response
2. Feline Infectious Peritonitis Modified Live Virus Vaccine (USDA: 15A1.20)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001544
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
3. Feline infectious peritonitis virus 7ab mutant vaccine
a. Type:
Live, attenuated vaccine
b. Status:
Research
c. Host Species as Laboratory Animal Model:
Cat
d. Gene Engineering of 7a
  • Type: Gene mutation
  • Description: This 7ab mutant is from Feline infectious peritonitis virus (Haijema et al., 2004).
  • Detailed Gene Information: Click here.
e. Gene Engineering of 7b
  • Type: Gene mutation
  • Description: This 7ab mutant is from Feline infectious peritonitis virus (Haijema et al., 2004).
  • Detailed Gene Information: Click here.
f. Immunization Route
Oronasal immunization
g. Cat Response
IV. References
1. Addie et al., 2009: Addie D, Belák S, Boucraut-Baralon C, Egberink H, Frymus T, Gruffydd-Jones T, Hartmann K, Hosie MJ, Lloret A, Lutz H, Marsilio F, Pennisi MG, Radford AD, Thiry E, Truyen U, Horzinek MC. Feline infectious peritonitis. ABCD guidelines on prevention and management. Journal of feline medicine and surgery. 2009; 11(7); 594-604. [PubMed: 19481039].
2. Haijema et al., 2004: Haijema BJ, Volders H, Rottier PJ. Live, attenuated coronavirus vaccines through the directed deletion of group-specific genes provide protection against feline infectious peritonitis. Journal of virology. 2004; 78(8); 3863-3871. [PubMed: 15047802].