VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Haemophilus parasuis

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. csgG (Protective antigen)
    2. FOG (Protective antigen)
    3. gapA (Protective antigen)
    4. gcp (Protective antigen)
    5. hsdS (Protective antigen)
    6. hxuB (Protective antigen)
    7. hxuC (Protective antigen)
    8. LppC (Protective antigen)
    9. ndk (Protective antigen)
    10. omp26 (Protective antigen)
    11. oppA (Protective antigen)
    12. outer membrane protein A (Protective antigen)
    13. outer membrane protein D15 (Protective antigen)
    14. outer membrane protein P2 (Protective antigen)
    15. palA (Protective antigen)
    16. pflA (Protective antigen)
    17. plpA (Protective antigen)
    18. rnfC (Protective antigen)
    19. superoxide dismutase (Protective antigen)
    20. tbpA (Protective antigen)
    21. tbpB (Protective antigen)
    22. TolC (Protective antigen)
    23. VtaA5 (Protective antigen)
    24. VtaA6 (Protective antigen)
    25. VtaA8 (Protective antigen)
    26. VtaA9 (Protective antigen)
    27. yfeA (Protective antigen)
    28. ygiW (Protective antigen)
  3. Vaccine Information
    1. Haemophilus Parasuis Avirulent Live Culture Vaccine (USDA: 19J1.00)
    2. pCgap DNA vaccine encoding glyceraldehyde-3-phosphate dehydrogenase
    3. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine-Erysipelothrix Rhusiopathiae-Haemophilus Parasuis Bacterin (USDA: 49V9.20)
    4. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine-Haemophilus Parasuis Bacterin (USDA: 49Q9.20)
  4. References
I. General Information
1. NCBI Taxonomy ID:
738
2. Disease:
Glasser's disease
3. Introduction
H. parasuis is a non-motile, small, pleomorphic rod in the family Pasteurellaceae, and is the etiologic agent of Glasser's disease. Glasser’s disease is characterized by fibrinous polyserositis, polyarthritis and meningitis. H. parasuis often produces acute septicemia, and its endotoxin induces disseminated intravascular coagulation, resulting in the formation of microthrombi in several organs (Oliveira and Pijoan, 2004).
4. Microbial Pathogenesis
H. parasuis colonizes the respiratory tracts of pigs, and can then cause systemic infection (Oliveira and Pijoan, 2004).
5. Host Ranges and Animal Models
Pigs
6. Host Protective Immunity
Early colonized pigs are protected against systemic infection by maternal antibodies. As maternal immunity decreases, these pigs are able to mount an active immune response to these virulent strains (Oliveira and Pijoan, 2004).
1. csgG
  • Gene Name : csgG
  • Sequence Strain (Species/Organism) : Haemophilus parasuis SH0165
  • NCBI Protein GI : ACL33081
  • Other Database IDs : CDD:224379
  • Taxonomy ID : 557723
  • Protein Name : putative lipoprotein, curli production assembly/transport component CsgG
  • Protein pI : 8.61
  • Protein Weight : 22023.72
  • Protein Length : 345
  • Protein Note : Curli biogenesis system outer membrane secretion channel CsgG [Cell wall/membrane/envelope biogenesis]; COG1462
  • Protein Sequence : Show Sequence
    >ACL33081.1 putative lipoprotein, curli production assembly/transport component CsgG [Glaesserella parasuis SH0165]
    MSNLKVGVLCFTVLTLVGCATEGSRVITPTSTQAAITASQYKGVKSVISVGKFDNKSSFQNGVFSDGADQ
    LGNQSKTILISHLQQTGRFSVVDRTNMSEIASEAKIKGKKQNLKGATYVITGDVTEFGRKTVGDHQLFGI
    LGRGKEQVAYAKVTLNVVNVETSEVVYSSQGAGEYNLSNREVLGFGGTASYDATLNGKVLDLAIREAVNS
    LVNGIESGSWQPSH
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Hong et al., 2011)
2. FOG
  • Gene Name : FOG
  • Sequence Strain (Species/Organism) : Haemophilus parasuis SH0165
  • NCBI Protein GI : ACL32772
  • Other Database IDs : CDD:276809
    CDD:290160
    CDD:285020
    CDD:304382
  • Taxonomy ID : 557723
  • Protein Name : possible outer membrane protein, FOG: TPR repeat protein
  • Protein pI : 9.94
  • Protein Weight : 54014.03
  • Protein Length : 584
  • Protein Note : putative protein binding surface [polypeptide binding]
  • Protein Sequence : Show Sequence
    >ACL32772.1 possible outer membrane protein, FOG: TPR repeat protein [Glaesserella parasuis SH0165]
    MPDLHFMKSSQFPFILLFVSPILLANPFADPVSFERLSQAVGFEQKFAKKSADLTASPKAVLSLPNPQSL
    EAQINQAIIEQQWQRLPTLLQAYQQQSHYDITLVHYALGAFYYGQQRYPEAIEHYQAVLAQQPTLAYPRF
    DLGVMLYENQQYRQATEQLTMAKANLAPSMQPLTERYLARMVEEQSWQPDFSLQYVRTDNVNNASSSPVV
    NINGRQFVKDKTALPQSAEGFRYGIGVSKAHNLAGNHYLNGSVHYSGVHYWDNQDYSEQSLRFSLGYQYR
    NAKMGLGVTPFIEQNWLGSPRYSRQFGATLHGYRYLTQKWIVSSRLTHNQKRYHDSLTASRYNGFQNSGA
    LTLRWQAVRSWQIFASIEANRDQTKEKASSSHKIGGTLGVIYRWKNWGSELSGGYAKRNFEGKHYLYGYK
    RVDNEYRANWSLWNKQWTWKGLMPKLNFSYVKIQSNIPDFYSRKTGEWFLTVEKRF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Yuan et al., 2012)
3. gapA
  • Gene Name : gapA
  • Sequence Strain (Species/Organism) : Haemophilus parasuis SH0165
  • NCBI Gene ID : 7278596
  • NCBI Protein GI : 498484148
  • Locus Tag : HAPS_RS00005
  • Genbank Accession : CP001321
  • Protein Accession : WP_010785946
  • Taxonomy ID : 557723
  • Gene Starting Position : 1
  • Gene Ending Position : 1020
  • Gene Strand (Orientation) : +
  • Protein Name : type I glyceraldehyde-3-phosphate dehydrogenase
  • Protein pI : 6.07
  • Protein Weight : 32717.08
  • Protein Length : 339
  • Protein Note : COG:G;COG0057
  • DNA Sequence : Show Sequence
    >NC_011852.1:1-1020 Haemophilus parasuis SH0165, complete genome
    TATGGCAATTAAAATTGGTATTAACGGCTTTGGCCGTATCGGTCGTATCGTATTCCGTGCAGCACAAAAA
    CGTGATGACATCGAAGTAGTTGGTATCAACGACTTAATTGATGTTGAGTATATGGCATATATGCTCAAAT
    ACGATTCAACTCACGGTCGTTTCGATGGCACTGTCGAAGTAAAAGACGGCAAATTAGTTGTAAACGGTAA
    AGAAATCCGTGTTACTTCTGAGCGTGACCCAGCTAACTTAAAATGGAATGAAATTGGTGTGGATATCGCA
    GTTGAAGCAACAGGTTTATTCTTGGACGATACAACTGCTCGTAAACACATCGAAGCTGGTGCGAAAAAAG
    TCGTTTTAACTGGTCCATCTAAAGATAGCACACCTATGTTCGTAAACGGTGTAAACTTCAACGCTTATGC
    TGGTCAAGACATCGTTTCTAACGCTTCTTGTACAACAAACTGCTTAGCACCACTTGCTCGTGTTATCCAC
    GAAACATTTGGTATCAAAGAAGGTTTAATGACAACTGTTCATGCAACAACAGCAACACAAAAAACTGTTG
    ATGGTCCATCAGCAAAAGACTGGCGCGGTGGTCGTGGTGCGGCACAAAACATCATTCCATCTTCAACAGG
    TGCAGCGAAAGCAGTAGGTAAAGTATTACCAGCATTAAACGGTAAATTAACAGGTATGGCGTTCCGTGTT
    CCAACAGCAAACGTATCTGTTGTTGATTTAACTGTAAACTTAGAAAAACCAGCAAGCTACGAAGAGATCA
    AAAAAGCGATCAAAGATGCAGCAGAAGGTAAAACATTCAACGGCGAATTAAAAGGCGTTTTAGGTTATAC
    TGAAGATGCAGTAGTATCAACAGACTTCAACGGTGCAGTTGAAACTTCTGTATTTGATGCAGATGCAGGT
    ATCGCATTAACAGATACATTCGTGAAACTTGTTTCTTGGTATGACAACGAAACTGGTTACTCAAACAAAG
    TATTAGACTTAGTTGCTCACGTTTACAACTACAAAGGCTA
    
    
  • Protein Sequence : Show Sequence
    >WP_010785946.1 type I glyceraldehyde-3-phosphate dehydrogenase [Glaesserella parasuis]
    MAIKIGINGFGRIGRIVFRAAQKRDDIEVVGINDLIDVEYMAYMLKYDSTHGRFDGTVEVKDGKLVVNGK
    EIRVTSERDPANLKWNEIGVDIAVEATGLFLDDTTARKHIEAGAKKVVLTGPSKDSTPMFVNGVNFNAYA
    GQDIVSNASCTTNCLAPLARVIHETFGIKEGLMTTVHATTATQKTVDGPSAKDWRGGRGAAQNIIPSSTG
    AAKAVGKVLPALNGKLTGMAFRVPTANVSVVDLTVNLEKPASYEEIKKAIKDAAEGKTFNGELKGVLGYT
    EDAVVSTDFNGAVETSVFDADAGIALTDTFVKLVSWYDNETGYSNKVLDLVAHVYNYKG
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Haemophilus Parasuis Avirulent Live Culture Vaccine (USDA: 19J1.00) , pCgap DNA vaccine encoding glyceraldehyde-3-phosphate dehydrogenase
4. gcp
  • Gene Name : gcp
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : EQA95212
  • Taxonomy ID : 456298
  • Protein Name : putative tRNA threonylcarbamoyladenosine biosynthesis protein Gcp
  • Protein pI : 4.89
  • Protein Weight : 35809.93
  • Protein Length : 458
  • Protein Sequence : Show Sequence
    >EQA95212.1 putative tRNA threonylcarbamoyladenosine biosynthesis protein Gcp [Glaesserella parasuis 29755]
    MKILGIETSCDETGVAIYDEAKGLVANQLYSQIEMHADYGGVVPELASRDHIRKTLPLIQEALKEANLTA
    SDIDGVAYTAGPGLVGALLVGSTIARSLAYAWNVPALGVHHMEGHLLAPMLEENAPEFPFVALLVSGGHT
    QLVDVKNVGEYELLGESIDDAAGEAFDKTAKLLGLDYPGGAALAKLAETGTPNRFTFPRPMTDRPGLDFS
    FSGLKTFAANTINANLNEKGELDQQTRCDIAYAFQQAVIETLIIKCRRALQQTGYKRLVIAGGVSANKQL
    RHDLSELMKQIGGEVFYPRPQFCTDNGAMIAYAGFLRLKNGEQTDLSVSVKPRWPMVELCPIDV
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Li et al., 2015)
5. hsdS
  • Gene Name : hsdS
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : ACL32369
  • Other Database IDs : CDD:279728
    CDD:223804
  • Taxonomy ID : 557723
  • Protein Name : type I restriction enzyme specificity protein HsdS
  • Protein pI : 7.36
  • Protein Weight : 45559.72
  • Protein Length : 509
  • Protein Note : Type I restriction modification DNA specificity domain; pfam01420
  • Protein Sequence : Show Sequence
    >ACL32369.1 type I restriction enzyme specificity protein HsdS [Glaesserella parasuis SH0165]
    MIESRFIEKLLKNREIEFKSLGDVTEMKRGKTITAKDASGGDIPVISGGQKPAYYHNEYNRNGKTITVAG
    SGAYAGFIMYWEEPIFVSDAFSIKSDETLLDLKYVYHFLLQHQQKIYGMKKGSGVPHVYPKDLSTLVIPI
    PPLDVQQEIVRILDAFTSLTAELTAELTAELTSRQKQYQYFRDKLLNFDDISDRGGYETNPITKALWHNK
    KVVFKTLGEVTTISIGLTYTPAYVEKGIKFISAQNTSKDYLDLSNVKYISEEEFENSTDNAKPQRDDILF
    TRVGSNIGHPVIVETDEKLCIFVSLGFLRVKDNNFLFNRYLKHWMSTDLFWKQVEKNVHGSAKINLNTGW
    LKDFKIPIPPFEEQQRIVAILDKFETLTNSIAEGLPKEIELRRKQYEYYREKLLSFPQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Li et al., 2015)
6. hxuB
  • Gene Name : hxuB
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : ACL33615
  • Other Database IDs : CDD:225387
    CDD:285653
    CDD:279448
  • Taxonomy ID : 557723
  • Protein Name : heme/hemopexin-binding protein B, hemolysin activation/secretion protein
  • Protein pI : 9.69
  • Protein Weight : 61003.04
  • Protein Length : 690
  • Protein Note : Hemolysin activation/secretion protein [Intracellular trafficking, secretion, and vesicular transport]; COG2831
  • Protein Sequence : Show Sequence
    >ACL33615.1 heme/hemopexin-binding protein B, hemolysin activation/secretion protein [Glaesserella parasuis SH0165]
    MKHFRRKNVITGIILSCVSGFTYANPIPDSGTLNKQLEQTRQIQVAKVKPSGELFKTPTQEENLPANKES
    LKFRLDSIKLLELDGNEIQDNLTSITSPYLHQEITLDDLNRLSQQITNYYRDNNYLVAKAFIPPQEINNG
    ELQIFVIKGSLDQVVVRNGSRLKEDLVMRMVNTTVKSHSYLVKNELEKLALLLNDIKGITSALSLKAGQN
    TGKTDLTVNLKDNKRWNGYISIDNQGNDNTGKYRTTLGNKIYNLVGLGDELHFDVLASNTFDLYNLRADY
    SFIIDGYGTRVGVNSNYLKYKLGANFKDLNAQGSTYNLGGYITHPTIRTASLRLDSKLAFNHQKLSDEQK
    SVDLQQKRKVNTTSIGVSGSWNSIKEGVTYFSFNTIFGKESHSTNEKKHYLSENYQPKRTFTTFNYSLSH
    EQFLPKSFSITFAASGQFADKNLDSGNKFLLGGLSGVKGYQAGTVSVDEGHIIQAELKHYLPVFSKSILV
    SSLFYDEGFGKQYKNTEKLSESVENKVRLKSIGVGLNLIEPNHYSINFAYAKPIGKKYNNVDKNQFWLSA
    IKTF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Wen et al., 2016)
7. hxuC
  • Gene Name : hxuC
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : ACL33614
  • Other Database IDs : CDD:273807
    CDD:238657
  • Taxonomy ID : 557723
  • Protein Name : heme/hemopexin utilization protein C/outer membrane receptor protein, mostly Fe transport
  • Protein pI : 9.8
  • Protein Weight : 77928.54
  • Protein Length : 853
  • Protein Note : TonB-dependent heme/hemoglobin receptor family protein; TIGR01785
  • Protein Sequence : Show Sequence
    >ACL33614.1 heme/hemopexin utilization protein C/outer membrane receptor protein, mostly Fe transport [Glaesserella parasuis SH0165]
    MRLSKIYTALFLSLPTVSLADSNVSAELAEISVIASRDAFHWANHTSEKATLNKNQLLTQQPISTADAIK
    RITNVDIAGGSRGIAQKPIIRGLSGNRVVQVIDGVRQNFDLSHRGSYFLPMALTQEIEVIKGPTSTLWGS
    GALGGIVAIRTPNALDLLKDNQQIGAKIHQGYQSANSLSETDVSVFAANDKFDGLVSGFYNHADDLRLAD
    SKKLVDSRYTQKGGLFKFGWQINDENRLELSHRLSHFEQIAPTNNEVAEEFTNQDVRNLIRNWHRNNPTA
    SFAEMTRFYKGLTSVLGSVSYRAKQKITDQSSALHYYFNPKDNDYINSQLTLYRNSTKEKEQRIASGLQD
    QTKLSTMGLNIRNSTDLNWLALNYGVDFISDRVVTQREKNATTPFRPNNYDAKSKNSAFYLLTHIPLWNE
    RIIVSPSVRYDHFKTQSDEAKYSASRWSPSIAATWKATNWLDLSTRYNKAFRTPSMQERFVSGSHFGTNL
    MGQSFNNTFVSNPNLRPETAKNKEIAAKVHFDNLFVHQDKFIFNAAYFQNDVKDFIHLDIFRASQRERIP
    SLSQYRNVENARLTGYELEFAYQQERLALGLNYAQTKGKNRQTQEALSNIPANKLGFTIDYALVPQTFMI
    GANITHYASQKRVPKTHAMTYPSYTLTDLKASYTPSGEWRNLRLDMMIENVFDKKFQPAFSLMEGAGRNI
    KLNASYQF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Wen et al., 2016)
8. LppC
  • Gene Name : LppC
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : WP_021117166
  • Other Database IDs : CDD:332423
  • Taxonomy ID : 738
  • Protein Name : lppC lipofamily protein
  • Protein pI : 5.9
  • Protein Weight : 61497.82
  • Protein Length : 653
  • Protein Note : LppC putative lipoprotein; cl27602
  • Protein Sequence : Show Sequence
    >WP_021117166.1 lppC lipofamily protein [Glaesserella parasuis]
    MPTILVQSYGFRQKMKTIFIPTALALLLAACSGNKVTETLKNEAYGNSEFYINKAEQSRNIEEQQSYRLL
    AVRKLIEENKVVEAQNTFSEILVAKLNDEQKLEHRLLIAQLAALQGNNSEAQGVLRALPQTLLSQSQRLR
    VYQTQARIAENQNDVIAAVNARALMDRYMTDTQSRQANNDKIWEMLRNANRGMLEKAVAGPGEIGLAGWL
    ALVVAYNQNMSNPAQLPQVIEMWKQQYPNHSATLLLPIELRNVSSFEQTQLNGVALLLPLSGDAKILGEI
    IKRGFDDAKGITTMPVQVFDTDSAPINDLLMQAKQQGAQTIIGPLLKPRVDEMLISPEISNINVLALNST
    PNVRAVAKVCYYGLSPEAEAHFAAERFLKDGLQNAVVVAPNGDFGTRSAEAFAQRWRQLTNRDTDIRYYN
    QAFEVASLLQGSVLGQGSGLYALGTAEQLSDLKQSLDNSPLANQFPIYTSSRSNSPNNGPDFRLTMEGVK
    FSEIPLLSDPSSSEYKKAEQIAESDFSMMRLYAMGSDTWSIANKFNEFRQIPGYKVHGLTGVLRAGPNCN
    LEREMNWLQYRGGSIVDAN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Li et al., 2017)
9. ndk
  • Gene Name : ndk
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : KEZ22119
  • Taxonomy ID : 738
  • Protein Name : Nucleoside diphosphate kinase
  • Protein pI : 6.53
  • Protein Weight : 15381.74
  • Protein Length : 207
  • Protein Sequence : Show Sequence
    >KEZ22119.1 Nucleoside diphosphate kinase [Glaesserella parasuis]
    MIQQTLAIIKPDATKRHLIGEILSYMEKNGLAIKALKMLHLTKEQAEGFYAEHQGKDFFDPLVAFMISEP
    IVVAVLEGENAVENYRLLMGATKPEERKLGTIRKMFGLGYRENSVHGSDSETSAKREIAYFFTPSEIV
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Li et al., 2015)
10. omp26
  • Gene Name : omp26
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : ACL32860
  • Other Database IDs : CDD:332039
  • Taxonomy ID : 557723
  • Protein Name : outer membrane protein 26
  • Protein pI : 8.4
  • Protein Weight : 28348.36
  • Protein Length : 341
  • Protein Note : Outer membrane protein (OmpH-like); cl27218
  • Protein Sequence : Show Sequence
    >ACL32860.1 outer membrane protein 26 [Glaesserella parasuis SH0165]
    MKNLFKLAAVASALAFSANTVNANEKIGFVDPNFLIQNHPLTIEANDKFTKFMKDTESKFAPREKQLAAE
    NKALSDEEKALLDERKKIEEDAQKLQKEQVTLEAAMKKKVAQLEKDAPRLKAKEIQARQDKINAEAKPFQ
    NKVSALQQREVEFGKKAEEFQKRADEFQKKVAAFQEEIAKVQKESGVITPEQVQQKVVEDINAKIKQVAE
    SKGYTLVLPPSVALYAKDGNAADITEEILVAMGGKMPEAPKTEVPAAEVTKPEEVKK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Li et al., 2016)
11. oppA
  • Gene Name : oppA
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : ACL32119
  • Other Database IDs : CDD:173869
    CDD:185059
  • Taxonomy ID : 557723
  • Protein Name : putative oligopeptide transporter, periplasmic-binding protein, OppA
  • Protein pI : 6.99
  • Protein Weight : 55956.24
  • Protein Length : 634
  • Protein Note : The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold; cd08504
  • Protein Sequence : Show Sequence
    >ACL32119.1 putative oligopeptide transporter, periplasmic-binding protein, OppA [Glaesserella parasuis SH0165]
    MASIQRIVQFIKKGLFVTACIVGFVACDPEENNGSVRPLPNAEPTNVLSRAIYATELQLDPHFVRISAEA
    GVVRDLFLGLMAFDPKGQIQNAVAKEWFSEDGKNWLFILDENAKWSNDQAVTSADFVASWQRLSDPKNAS
    PLAHYLVYMGIVNSRAVLAGELPPDALGVKALNPYTLQVQLEKANYQLPKMLAHSALLPTYLGQKPNSTD
    LVSNGSYRVEHFEKNLLQLKARDKNTPFQVVQYHLITSVQNPSRFDIIENPLENYHQHEKRFARLCNYFY
    EFNFNDPLFAQKPIRQAVRAMISPIEISKGNGIPSHLMIPKQLFSEMGHSLSHTNVEQLLNEQGIHSGNP
    LKLTLSYDRQGQHSQIAARIVRALGQSELFRVQLQAVSWEELLAKREHKDFQLIRSGWCADYPDPVLFLT
    QFHSQSPDNKSSYSNAKVDELLLQLQEQPLDTAQRQRIIATIAHQLEEDVAILPLFQYQRRMSIAPTIQG
    FDEQNASETIYSKDLTRQYHKDK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Macedo et al., 2016)
12. outer membrane protein A
  • Gene Name : outer membrane protein A
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : ACN62162
  • Other Database IDs : CDD:236764
    CDD:279698
    CDD:143586
  • Taxonomy ID : 738
  • Protein Name : outer membrane protein A
  • Protein pI : 9.52
  • Protein Weight : 36308.42
  • Protein Length : 435
  • Protein Note : outer membrane protein A; Reviewed
  • Protein Sequence : Show Sequence
    >ACN62162.1 outer membrane protein A [Glaesserella parasuis]
    MKKSLIALAVSGLAVASVAQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDATNLKYGISRNSV
    TYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGTHLSLKPSYEVLNGLDVYGKVGAALVRN
    DYKRYSQTAGVQTQKAHNLKTSLVLGAGVEYAILPELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPD
    SHSVTAGISYRFGQGAAPVAAAPEVVTKNFAFSSDVLFDFGKANLKPAAAQTLDAVHTEIVNLGLANPAV
    QVNGYTDRIGKDAANLTLSQKRAETVANYIVSKGVNPANVTAVGYGEANPVTGNTCDAVKGRKALITCLA
    PDRRVEIQVQGSKEVSM
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Tian et al., 2011)
13. outer membrane protein D15
  • Gene Name : outer membrane protein D15
  • Sequence Strain (Species/Organism) : Haemophilus parasuis str. Nagasaki]
  • NCBI Protein GI : ACI05267
  • Other Database IDs : CDD:236834
    CDD:284624
    CDD:279448
  • Taxonomy ID : 738
  • Protein Name : outer membrane protein D15
  • Protein pI : 7.65
  • Protein Weight : 85698.04
  • Protein Length : 881
  • Protein Note : outer membrane protein assembly factor YaeT; Provisional
  • Protein Sequence : Show Sequence
    >ACI05267.1 outer membrane protein D15 [Glaesserella parasuis]
    MKKLLLSTLLVANGVAFASPFVIKDIRIDGIQTSVSQTMIPTLPVKVGQLATDNDIANVIRHLFVQNRFQ
    NISATREGDILIIKVVENPVINNVDIEGNSAIPKEPLEQNLKANLITKGELFNSTKLDAFKSALIEHYHS
    IGRYNATIDTVITNSDNGGVNIKLDIKEGDVAYVKAINFEGNQAFTSKVLMKQLDIQPDVSWFNIFQSSK
    FEQTAYNQDLENLRNFYMNQGYAKFNVEAEQPVFSDDKKEVSLTYKINEGIPYTVSEIRIVGNTAKLDNE
    LNEQLKYYKTGELFSKNELSKIEDNIKQVFGNNGFASAKIELHPTFDDTNKTIRLTFVVDAGQRVYVRQI
    RFEGNDVTADSTLRREMRQQEGAWLSTSLAALGKARLERTGFYDSVEMSYPNVPNTADQVDIVYKIKERN
    TGSINFGVGYGTESGLSYQAGIKQDNFLGMGSTISLNGTRNDYGTSINLGYTEPYFTKDGVSLGGNIFYE
    DYDNSKNNSVASYKRQTYGVNSTLGFPVNEYNSYFLGLGYTQDLIKNARREFNRELYVQSMKFPIDNDLN
    VYKKIKANDFDFSFGWNYNSLNRGFLPTEGTLTSISGRITTPGSDNKYYKVSIDFKNYLPVNREHKWVIS
    TKANIAYANGFSGKELPFYQTYTAGGIGSLRGFAYGAIGPKAIYLGKDNNGNIRFNSVNRDIVGGNAMAS
    ATLELITPTPFVSEKYQHNVRTSLFVDAATVLNTKWKTNPVVNDIQYNYSSLENFKDYKRFRASTGIAFQ
    WNSPIGPLVFSYAKPIKKYQGDEIEQFQFSIGGSF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Zhou et al., 2009)
14. outer membrane protein P2
  • Gene Name : outer membrane protein P2
  • Sequence Strain (Species/Organism) : Haemophilus parasuis str. Nagasaki]
  • NCBI Protein GI : EYE71716
  • Taxonomy ID : 1117322
  • Protein Name : outer membrane protein P2 (OMP P2)
  • Protein pI : 9.55
  • Protein Weight : 36557.65
  • Protein Length : 451
  • Protein Note : COG3203 Outer membrane protein (porin)
  • Protein Sequence : Show Sequence
    >EYE71716.1 outer membrane protein P2 (OMP P2) [Glaesserella parasuis str. Nagasaki]
    MKKTLVALAVAAFAASASAVTVYENEGTKVDFDGQLRLLLEEQATKEKGQSSTGGHTNLKNNGSRFGISI
    KHNINENLYGFGRYETRLDSNSKNAAGWGDVKTKYAYVGLGGYGHEISFGKQDVIGDSIGQAGFDKVYGV
    GTGGIKYSANNTNKKGFDILTSDSDSAINYTYTGIEGLTLGANYNVANERDKKTGEVNVGSTKSGFGLGA
    KYTAKIAESQSVTVAAGYTHDDYKSGSVNKKDKDGVYFGLKYVNAPFTVAVDGGHGVEKTGNVKEKIDFV
    RTGARFDVTPKSGVYGNYSYGTYKDKAYKATAHQFMLGADYKLHKQVVTFVEGRLIKNKDSNNKKVTDQA
    LGVGLRVLW
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Zhou et al., 2009)
15. palA
  • Gene Name : palA
  • Sequence Strain (Species/Organism) : Haemophilus parasuis SH0165
  • NCBI Protein GI : ACL31779
  • Other Database IDs : CDD:274307
    CDD:143586
  • Taxonomy ID : 557723
  • Protein Name : 18K peptidoglycan-associated outer membrane lipoprotein, precursor PalA
  • Protein pI : 7.56
  • Protein Weight : 16062.54
  • Protein Length : 272
  • Protein Note : peptidoglycan-associated lipoprotein; TIGR02802
  • Protein Sequence : Show Sequence
    >ACL31779.1 18K peptidoglycan-associated outer membrane lipoprotein, precursor PalA [Glaesserella parasuis SH0165]
    MKKLAKVLMIAAPAFVLAACSSSNDNASANASANAGQTFGGMSVQDLQTRYNTVYFDFDSYTLKAEDQQL
    LDAHAQYLVASKGKVTVAGHADERGTPEYNIALGQRRADAVKDFLATKGASNVATVSYGEEKPAVLGHSE
    ADYSKNRRAVLEY
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Zhou et al., 2009)
16. pflA
  • Gene Name : pflA
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : AMW15937
  • Other Database IDs : CDD:182994
    CDD:302752
    CDD:100105
  • Taxonomy ID : 738
  • Protein Name : pyruvate formate lyase-activating enzyme 1
  • Protein pI : 5.79
  • Protein Weight : 26955.76
  • Protein Length : 330
  • Protein Note : pyruvate formate lyase-activating enzyme 1; Provisional; PRK11145
  • Protein Sequence : Show Sequence
    >AMW15937.1 pyruvate formate lyase-activating enzyme 1 [Glaesserella parasuis]
    MTVLARYHSYESCGTVDGPGIRFILFLQGCLMRCKYCHNRDTWDLEGGKEISVENLMKEVVTYKHFMRAT
    GGGVTASGGEAVLQMEFVRDWFRACKAEGIDTCLDTNGFVRNYSELVDEMLDVTDLVMLDLKQLNEEIHK
    DFIGVSNKRTLDFARYLHKRNQRTWIRYVVVPGYTDADEDIHLLGQFIQGMDNIEKVELLPYHRLGAHKW
    KTLGLEYELEDVMPPTKESLEHIKGIIESYGHTVKY
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Li et al., 2015)
17. plpA
  • Gene Name : plpA
  • Sequence Strain (Species/Organism) : Haemophilus parasuis SH0165
  • NCBI Protein GI : ACL32115
  • Other Database IDs : CDD:304360
    CDD:270316
  • Taxonomy ID : 557723
  • Protein Name : ABC-type metal ion transport system, periplasmic component/outer membrane lipoprotein 1 precursor
  • Protein pI : 6.05
  • Protein Weight : 27893.2
  • Protein Length : 425
  • Protein Note : Type 2 periplasmic binding fold superfamily; cl21456
  • Protein Sequence : Show Sequence
    >ACL32115.1 ABC-type metal ion transport system, periplasmic component/outer membrane lipoprotein 1 precursor [Glaesserella parasuis SH0165]
    MNFKKLLGLAVVSALALTGCKEEKKAEAPAVAPAPAAQAQKIKVGVMSGPEHTVAEKAAQIAKEKYGLEV
    EFVLFNDYALPNTAVSKGDLDANAFQHKPYLDKDSASKGLDNLVIVGNTFVYPLAGYSKKIKNVAELQDG
    AVIAVPNDPSNLARALILLEKQGLIKLKDNTNLFSTSLDIVENPKNLKIQEVDTSVAAKALDDVDLAVVN
    NTYAGQVGLNATEHGVFVENKESPYVNIIVARKDNQASEAVQNFMKAYQTEEVFQEAQKHFKDGVVKGW
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Hong et al., 2011)
18. rnfC
  • Gene Name : rnfC
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : KEZ22306
  • Taxonomy ID : 738
  • Protein Name : Nitrogen fixation protein rnfC
  • Protein pI : 8.11
  • Protein Weight : 75511.08
  • Protein Length : 819
  • Protein Sequence : Show Sequence
    >KEZ22306.1 Nitrogen fixation protein rnfC [Glaesserella parasuis]
    MQADVLSRIREGKLWDFPGGIHPPEMKKQSNQKPIRSLHLPKFFYVPVLQHSGTAGDVIVQQGDLVLKGQ
    ALTKGDNYRQLPVHSPTSGKVVAIQPHVSSHPSGLPELTIVIETDGEDKWIERQPIDDFLSLTSDQIIQK
    VYQAGIAGLGGAVFPTSHKLHFADKRCKLLIINGAECEPYITCDDRLMQDYADEMIEGVRILRYVLRPED
    VVIAIEDNKPKAIQAVEKALKGANDISVRVIPTKYPSGVSDQLVQVLTGLEIPQGKRTIEMGIVMHNVGT
    AFAVKRAVMDDEPLIERVVTLTGDKIRNKGNVWARLGTPILHLLEQVDYQADERFPVFLGGPMMGFILPS
    LQSPITKTANCIIAPDHFEYAPPEPERNCIRCSSCSDACPVGLLPQQLYWFARAEDHDKSKEYHLDACIE
    CGVCAYVCPSYIPLIQYFRQEKAKIQEVDQKAKQAEEAKIRFEAREARLNKEKEARTARIQQAAEKRREE
    VANSQGEDPVKAALERLKAKKAETATPVQTKANGEPDNSELMAQRKARRLAKQVEVSPLPDSRDITSLES
    VPLPQAGEGNDPRKAAVAAALARAKAKKEAQQAVTSDENTAKAEVAEDPRKAAVAAALARAKAKKEAQQA
    AVSDENVAKAEVAEDPRKAAVAAALARAKAKKEAQQAVVSDENVAKAEVAEDPRKAAVAAALARAKAKKE
    AQQAVVSDENVAKAEVAEDPRKAAVAAAIARAKAKKEAQK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Li et al., 2015)
19. superoxide dismutase
  • Gene Name : superoxide dismutase
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : AIK91190
  • Other Database IDs : CDD:224943
    CDD:238186
  • Taxonomy ID : 738
  • Protein Name : superoxide dismutase
  • Protein pI : 7.82
  • Protein Weight : 18281.37
  • Protein Length : 241
  • Protein Note : Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism]; COG2032
  • Protein Sequence : Show Sequence
    >AIK91190.1 superoxide dismutase [Glaesserella parasuis]
    MKKTVLTLALTALFGFSTSAIANSATQIEVKVQQLDLQNGNKDVGTVTITESPYGLVFTPNLKGLSHGLH
    GFHIHEKPSCEPKEKDGKLVAGLGAGGHWDPKETKKHGYPWSDEAHLGDLPALAVDHEGNATNPVLAPRL
    KKLEEVKGRSLMIHAGGDNHSDHPAPLGGGGARMACGVIN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Guo et al., 2017)
20. tbpA
  • Gene Name : tbpA
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : AAV68900
  • Other Database IDs : CDD:273799
    CDD:238657
  • Taxonomy ID : 738
  • Protein Name : TbpA
  • Protein pI : 9.6
  • Protein Weight : 102011.022
  • Protein Length : 988
  • Protein Note : TonB-dependent lactoferrin and transferrin receptors; TIGR01776
  • Protein Sequence : Show Sequence
    >AAV68900.1 TbpA [Glaesserella parasuis]
    MKNKLNLISLALLSLFAVQSYAEQAVQLNDVYVTGTKKKAHKKENEVTGLGKVVKTPDTLSKEQVLGIRD
    LTRYDPGISVVEQGGATTGYSIRGVDRNRVGLALDGLPQIQSYVSQYSRSSSGAINEIEYENLRSIQISK
    GASSSEFGSGSLGGSVQFRTKEVSDIIKPGQSWGLDTKSAYSSKNQQWLNSLAFAGTHNGFDALVIYTHR
    DGKETKAHKDAESRSQNITRVGVETNELDTSNRYTATTNNQHTYGWFLIKDECPTLDCTPKQMARVTKDT
    PSFRSYPEYTPEEKQAYENQKHITERLNAQDYTGEYRALPDPLKYKSDSWLVKLGYTFSPKHYVAGTYEH
    SKQRYDTRDMTYTAYWQPSDLLRTGRNWYPMNNAKGLYRDNALDGVAIDYFTEDGVKSSKGLRWAKARFI
    DEWHTRDRLGALYRYTNQDGNRLIDRLSLSFDQQKINLSTRLRENNCSEYPTIDKNCRATLDKLWSSTKN
    EQSSYEEKHDTIQLSLDKTVQTGLGKHQLNMLLGSDRFNSTLKRHEILSEFSVGTWGLVRDIGYRNGSYN
    NPYVYELKDRAIYSKNDYSGTIAGRADCATSKIKGHNHYIALRDNFAITKYLDIGLGYRFDKHKFRSTHR
    WANQGDYKNSAWNIGIVAKPTSFLSLSYRASSGFRVPSFQELFGLRYDGAMKGSSDAYQKTEKLSPEKSL
    NQEVAATFKGDFGVVEVSYFKNDYKQLIAPAERMHQTQSMINYFNVQDIKLDGINLIGKLDWNGVFDKIP
    EGIYTTLAYSKMRVKEVKNYQGYMNIRSPLLDTIQPARYVVGVGYDQPDEKWGVNLTMTHSSGKNPNELR
    GNEQVGFANYERTATKKRTRSWHTFDLTGYITPWKHTTVRAGVYNLMNYRYTTWESVRQXSLNAIHQHTN
    VKDYARYAAPGRNYVVSFEMKF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Huang et al., 2013)
21. tbpB
  • Gene Name : tbpB
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : AAV68899
  • Other Database IDs : CDD:279621
  • Taxonomy ID : 738
  • Protein Name : TbpB
  • Protein pI : 6.92
  • Protein Weight : 62210.98
  • Protein Length : 643
  • Protein Note : Transferrin binding protein-like solute binding protein; pfam01298
  • Protein Sequence : Show Sequence
    >AAV68899.1 TbpB [Glaesserella parasuis]
    MHFKLNPYALAFTSLFLVACSGGKGGFDLEDVRPNQTAKAEKATTSYQDEETKKKTKEELDKLMEPTLGY
    ETQILRRNKAPKTETGEKRNERVVELSEDKITKLYQESVEIIPHLDELNGKTTSNDVYHSHDSKRLDKNR
    DLKYVRSGYVYDGSFNEIRRNDSGFHVFKQGIDGYVYYLGVTPSKSYQRESHSYKGTWDLLSNINLDREI
    DGFDTSGDGKNVSATSITETVNRDHKVGEKLGDNEVKGVAHSSEFAVDFDNKKLTGSLYRNGYINRNKAQ
    EVTKRYSIEADIAGNRFRGKAKAEKAGDPIFTDSNYLEGGFYGPKAEEMAGKFFTNNKSLFAVFAAKSEN
    GETTTERIIDATKIDLTQFNAKELNNLGDASVLIIDGQKIDLAGVNFKNSKTVEINGKTMVAVACCSNLE
    YMKFGQLWQKEGKQQVKDNSLFLQGERTATDKMPAGGNYKYVGTWDALVSKGTNWIAEADNNRESGYRTE
    FDVNFSDKKVNGKLFDKGGVNPVFTVDATINGNGFIGSAKTSDSGFALDAGSSQHGNAVFSDIKVNGGFY
    GPTAGELGGQFHHKSDNGSVGAVFGAKRQIEK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Barasuol et al., 2017)
22. TolC
  • Gene Name : TolC
  • Sequence Strain (Species/Organism) : Haemophilus parasuis
  • NCBI Protein GI : WP_075604781
  • Other Database IDs : CDD:224455
  • Taxonomy ID : 738
  • Protein Name : TolC family protein
  • Protein pI : 9.06
  • Protein Weight : 49474.35
  • Protein Length : 530
  • Protein Note : Outer membrane protein TolC [Cell wall/membrane/envelope biogenesis]; COG1538
  • Protein Sequence : Show Sequence
    >WP_075604781.1 TolC family protein [Glaesserella parasuis]
    MKVSKLTFTLLSALVLSACTNMSNDGSLQKAQQDYQQYQDITKQYQINEQWWLGYNDTQLNRLVETALGN
    NINLAKTAISVNKALYNANLVGANLVPTFTASEKSSASKGVGSSSNLNSTGTSSIGHQIGLNLSYTLDLW
    GRLRDTASAAEWEHKATQEDLQAARLSLINAVVSSYYNLAYYQDAIRITQQSVKSYEQLNHILSNKFKQG
    LIDQLSVDQSMQAVLSAQNALINLQSAQKSSEQVLRNLLNLKPNEPLVVNYPSILKVKLQDVDVNVPVST
    IANRPDVLASLKRLQGAFKNLTATENSWFPTVTLGGSLTGSSTKFNNTSDNPVAGGVVSFDLPFLDWNRV
    QNNIKISEEGYKLAKLNYEQTVTTALNEIDTYYSTYQLSKSGYANLQKKYEYDRKISGYYKNRYEQGISE
    LREWLSAMNTERSSELSLLENKYTLLKNENAIYQAMAGKYRK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Li et al., 2017)
23. VtaA5
  • Gene Name : VtaA5
  • Sequence Strain (Species/Organism) : Haemophilus parasuis str. Nagasaki
  • NCBI Protein GI : EYE71559
  • Taxonomy ID : 1117322
  • Protein Name : VtaA5
  • Protein pI : 9.78
  • Protein Weight : 102402.53
  • Protein Length : 1172
  • Protein Note : COG5295 Autotransporter adhesin
  • Protein Sequence : Show Sequence
    >EYE71559.1 VtaA5 [Glaesserella parasuis str. Nagasaki]
    MNKIFRVIWSHAQQAWVVVSELVKSHTKTSAYTDKRAQVCTSDYFLDKQQDKFKLSLLSLVLLSIFFSPV
    AVGAQLHTGTPYTAGGGSKSDRGSDDGTISIGKKSKASYGAIAIGEESKAEARHNVAIGYKADSGTDANS
    ITIGYNTKVSGEQGIAIGKQSKAGGRSVVLGGGAEGTTTQTVVIGNLAKATGSQSIAIGANTKAEGYGSI
    SIGGDDLDSTAYHDNNSTKQTRQTTTAKGKASVAIGGLSLATGDGSTVLGPLASASHVEGIAIGARSKST
    NEYGIAVGGSATAGKNAVAVGRDSKGAGTDSIAIGNSAKTTGADSVVVGASINVTGEKLVAIGRQANAGS
    HSTALGYKASAGGMHSVAVGESAMTNDGAARATALGNNTVVTVGGGVALGYGSRAETRGGIEGAKQTYSV
    TTGGSTVENGFKSTENVDGNNIGAVSVGGGSGNKLINRQITNVAAGKELTDAVNVAQLKSLTMKIAGDTG
    NSDNEKVGIWEGTLKVLGTSGEIKTSASNDTITLKLDETLKNKIDKIDNLGWKLKIAQGMGGKATNPPAE
    QLIKMDQTVTFTAGKNIKLEQAGGNITISTIGKLIEKTEWKNGNLQITYTDGSSDTIAKGKDGKNGEKGD
    RGEPGPRGEPGIPGPAGPVGPMGPAGAAGLVGPMGPQGPAGPPGPVGPAGAAGPKGDKGEPGQAGPAGPR
    GPAGPKGDTGQRGETGSAGPAGPKGEPGPKGEQGIPGQAGPAGPRGPQGTAGAQGPKGDKGEPGEAGPAG
    PRGPAGPKGDAGPKGDTGQRGETGSAGPTGPKGEPGPKGEQGIPGPAGPAGPKGDKGDTGPAGPQGPAGP
    TGPQDPAGPTGNSELKGITSIANGNDATKANGAKITLSAGSTDKTVNVNDAKITNVAAGTADTDAVNVSQ
    LNTKAAASKTEVEAGKNVKVTSKTGANGQNIYNVSVSGDLSDITSISNGDTKVSLGKDKQGNPVVNMNGA
    RITNVGDGSAEGDIVNVRQLNKVVSSVNTGFNQLSRDIGRVDVNARAGIASAGAMANLPQISLPGKSAIS
    VSNAQYRGQSAYAIGYSRISDNGKWLIRASVSSNTQRDTMIGGGVGFVW
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Olvera et al., 2011)
24. VtaA6
  • Gene Name : VtaA6
  • Sequence Strain (Species/Organism) : Haemophilus parasuis str. Nagasaki
  • NCBI Protein GI : EYE72607
  • Taxonomy ID : 1117322
  • Protein Name : VtaA6
  • Protein pI : 9.78
  • Protein Weight : 96152.6
  • Protein Length : 1125
  • Protein Note : COG5295 Autotransporter adhesin
  • Protein Sequence : Show Sequence
    >EYE72607.1 VtaA6, partial [Glaesserella parasuis str. Nagasaki]
    MNKIFRVIWSHDQQAWVVVSELVKSHTKTSACTDKRAQVCTSHYFLDKQQDKFKLSLLSLVLLGIFFSPP
    AGSATHSGTPYTADGGSRSNLGSDDGTISIGKESKASYGAIAIGQRSKAEGRHGIAIGYQTNAGTHVNSV
    AVGNDIRVSGEEAVAIGSSSKAGKGSVVLGRQADAANIEQAVVIGNLAKASKAQSIAIGANTKAEGYGSI
    SIGGDDLKTTKYQTGNQGQSKTTTAKGKASVAIGGLSLATGDGSIVVGPLASASHVEGIAIGARSKSTNE
    YGIAVGGGATAGKNAVAVGRDSNGGGTDSIAIGNSAKTTGADSVVVGANINVTGEKLVAIGREANSGSHS
    TALGYKASAGGMHSVAVGESAMTNDGAARATALGNNTVVTVGGGVALGYGSNASTAGGVEGLKQTHSVTT
    EGSTVANGFKSTQSVDNNAIGAVSVGGGSGNKLINRQITNVAAGKELTDAVNVAQLKSLTLKIEGNENKH
    NGVNANLSSADRPKVGLWSGTLKVKGDNGLTSHASGDTITVKLTDDTKSKIDKIDNLGWKLKIAQGMGGK
    ATNPPTEHLVKMSDTATVTFTAGNNIKLEQTNGNITISTIGKLIKETKMVNGNLQITYTDGSSNTITRGE
    KGDTGPRGETGPAGPPGPMGPAGAAGPAGAAGLVGPMGPQGPAGPPGPVGPAGAAGPKGDKGEPGQAGPA
    GPRGEPGQAGPAGPRGPAGPKGDAGPKGDTGQRGETGPAGPAGPKGEPGPKGEQGIPGPAGPTGPKGDKG
    DTGPAGPQGPAGPTGPQGPAGPAGAKGDKGDTGPAGPQGPTGPTGSQDPAGPTGNSELKGITSIANGNDA
    TKANGAKITLSADSTDKTVNVNDAKITNVAAGTADTDAVNVSQLNTKAAASKTEVEAGKNVKVTSKTGAN
    GQNIYNVSVSGDLSDITSISNGDTKVSLGKDKQGNPVVNMNGARITNVGDGSAEGDIVNVRQLNKVVSSV
    NTGFNQLSRDIGRVDVNARAGIASAGAMANLPQISLPGKSAISVSNAQYRGQSAYAIGYSRISD
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Olvera et al., 2011)
25. VtaA8
  • Gene Name : VtaA8
  • Sequence Strain (Species/Organism) : Haemophilus parasuis str. Nagasaki
  • NCBI Protein GI : EYE72886
  • Taxonomy ID : 1117322
  • Protein Name : VtaA8
  • Protein pI : 9.41
  • Protein Weight : 94207.97
  • Protein Length : 1080
  • Protein Note : COG5295 Autotransporter adhesin
  • Protein Sequence : Show Sequence
    >EYE72886.1 VtaA8 [Glaesserella parasuis str. Nagasaki]
    MNKIFRVIWSHAQQAWVVVSELVKSHTKTSAYTDKRAQVCTSDYFLDKQQDKFKLSFLSLVLLGIFFSPV
    GSARLFLDEARQGSAGVDDGSIGIGRESKVGPGSITIGQKSEAEGRTAVAIGYSAKTGSEHDNAIAIGNS
    SKATGPGTVTVGHSSQAKDRSVVLGANAEGKNAQTVVIGTLAKASASQSIAIGADTKAEGYGSISIGGDD
    LDQTKYNDNNSTNQPRHTTTAKGKASVAIGGLSLAEGDGSIVVGPLASASDVEGIAIGARSKSTNEYGIA
    VGGGATAGKNAVALGRESKGAGTDSIAIGNSARTTGADSVVVGANIDVTDEKLVAIGYQASAKSHATALG
    YMASAGGMHSVAVGESAMTNDGAARATALGNNTVVTVGGGVALGYGSRAETRGGIEGAKQSYSVTTGTSS
    VDNGFKSTGSVDNNSIPIGAVSVGNNKIKRQIVNVAAGKELTDAVNVAQLKSLTLKIAGNTSEQTQPAVG
    LWEGTLKVMGTSGEIKTSASGDTITLKLDETLKNKINTIDNLGWNLKIAKGAGEANPPNAAHLIKMSDTA
    TVTFTAGNNIKLEQTNGNITISTIGKLIAKTEWENDGLKITYTDGMHDIIKKGEKGDRGERGLRGETGPA
    GPAGPMGPAGAAGLVGPMGPQGPAGPPGPVGPAGAAGPKGDKGEPGQAGPTGPRGPAGPKGDAGPKGDTG
    QRGETGPAGPAGPQGPAGPTGPRGDKGDTGPAGPQGPAGPTGPQGPAGPTGSQDPAGPTGNSELKGITSI
    ANGNDATKANGAKITLSAGSTDKTVNVNDAKITNVAAGTADTDAVNVSQLNTKAAAARTEVEAGKNVKVT
    SKTGANGQNIYNVSVSGDLSDITSISNGDTKVSLGKDKQGNPVVNMNGARITNVGDGSAEGDIVNVRQLN
    KVVSSVNTGFNQLSRDIGRVDVNARAGIASAGAMANLPQISLPGKSAISVSNAQYRGQSAYAIGYSRISD
    NGKWLIRASVSSNTQRDTMIGGGVGFVW
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Olvera et al., 2011)
26. VtaA9
  • Gene Name : VtaA9
  • Sequence Strain (Species/Organism) : Haemophilus parasuis str. Nagasaki
  • NCBI Protein GI : EYE71168
  • Taxonomy ID : 1117322
  • Protein Name : VtaA9
  • Protein pI : 9.71
  • Protein Weight : 88376.07
  • Protein Length : 1024
  • Protein Note : COG5295 Autotransporter adhesin
  • Protein Sequence : Show Sequence
    >EYE71168.1 VtaA9 [Glaesserella parasuis str. Nagasaki]
    MNKIFRVIWSHAQQAWVVVSELVKSHTKTSAYTDKRAQVCTSDYFLDKQQDKFKLSLLSLVLLSIFFSPV
    AVGAQLHTGTAFLLDGSNKSKLGTDDGTIGIGKDSKAGYGAIAIGQYSKAKARHNVAIGYKADSGVQPNT
    ITIGYNTKVSGQEAIAIGKESKAGKESVVLGGQASAANIEQAVVIGHSATASASQSIAIGARSKSTADYG
    IAVGGGATAGKNAVAVGRDSKGAGTDSIAIGNSAKTTGVDSVVVGANINVTDGQLVAIGREAKAGSHSTA
    LGYKASAGGMHSVAVGESAMTNDGAARATALGNNTVVTVGGGVALGYGSNASTAGGVVGLKQNHSVTTGE
    STVDNGFKSTESVDNNPNPIPIGAVSVGNNNIKRQIVNVAAGKELTDAVNVAQLQSLTMKISGDNSSSGK
    VGIWDGTLKVVGTSGQIKTSANGDTITLKLDETLKNKIDNIDNLGWKLAITKGSGGEVTTPNTPYLIKMS
    DMATVTFTAGNNIKLEQADGNITISTIGKLIAKTEWENDGLKITYTDGMHDIIKKGEKGDRGEKGPKGDR
    GETGSAGPAGPAGAQGPVGPAGPAGPTGPQGATGPAGPKGEAGAAGPKGEKGDPGPKGEAGSTGPTGPAG
    PKGDPGQAGPKGDTGQKGETGPAGPAGPQGPAGPAGAKGDKGDTGPAGPRGPAGPTGPQGPAGPAGPQDP
    AGPTGNSELKGITSIANGNDATKANGAKITLSAGSTDKTVNVNDAKITNVAAGTADTDAVNVSQLNTKAA
    ASKTEVEAGKNVKVTSKTGANGQNIYNVSVSGDLSDITSISNGDTKVSLGKDKQGNPVVNMNGARITNVG
    DGSAEGDIVNVRQLNKVVSSVNTGFNQLSRDIGRVDVNARAGIASAGAMANLPQISLPGKSAISVSNAQY
    RGQSAYAIGYSRISDNGKWLIRASVSSNTQRDTMIGGGVGFVW
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Olvera et al., 2011)
27. yfeA
  • Gene Name : yfeA
  • Sequence Strain (Species/Organism) : Haemophilus parasuis SH0165
  • NCBI Protein GI : ACL32714
  • Other Database IDs : CDD:238557
  • Taxonomy ID : 557723
  • Protein Name : chelated iron ABC transporter, periplasmic-binding protein
  • Protein pI : 8.15
  • Protein Weight : 30617.57
  • Protein Length : 400
  • Protein Note : Metal binding protein PsaA. These proteins have been shown to function as initial receptors in ABC transport of Mn2+ and as surface adhesins in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that...; cd01137
  • Protein Sequence : Show Sequence
    >ACL32714.1 chelated iron ABC transporter, periplasmic-binding protein [Glaesserella parasuis SH0165]
    MKKLAALLSMLFLVSNPLAAQQFKVVTTFTVIQDIAQNVAGDKAVVESITKPGAEIHDYQPTPQDIVKAQ
    SADLVLWNGMNLESWFERFFAQVKDKPAVVVTEGIEPISIYEGPYKDKPNPHAWMSTKNALIYIENIRQA
    LVKYDPANAEAYNANAKAYADKIVALDQPLRERLAKVPEAQRWLVTSEGAFSYLARDYGFKELYLWAINQ
    DEQGTPKQIRKVIDQVRKHQIPVVFSESTISDKPAKQVAKESKARYGGVLYVDSLSTKDGKVPTYIDLLN
    VTVSTIVAGFEK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Hong et al., 2011)
28. ygiW
  • Gene Name : ygiW
  • Sequence Strain (Species/Organism) : Haemophilus parasuis D75
  • NCBI Protein GI : EQA00462
  • Taxonomy ID : 1117322
  • Protein Name : ygiW domain protein
  • Protein pI : 5.7
  • Protein Weight : 14278.97
  • Protein Length : 205
  • Protein Sequence : Show Sequence
    >EQA00462.1 ygiW domain protein [Glaesserella parasuis str. Nagasaki]
    MKKAIILTTLLAVSTVSMAKGDDDYRHGGYHDGKARTHQSQGFFDESIAVKSVADALKAADDTPALLEGQ
    IVKQIDKDEFIFKDATGEIEIDVSKRAWNGLNIGPQDTIQIRGKVDNDWNKVQVDVKQITKK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Yuan et al., 2012)
III. Vaccine Information
1. Haemophilus Parasuis Avirulent Live Culture Vaccine (USDA: 19J1.00)
a. Manufacturer:
Newport Laboratories, Inc.
b. Vaccine Ontology ID:
VO_0001794
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
g. Gene Engineering of gapA
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
2. pCgap DNA vaccine encoding glyceraldehyde-3-phosphate dehydrogenase
a. Vaccine Ontology ID:
VO_0004515
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of gapA
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
pcDNA3.1 Directional TOPO vector (pcDNA3.1D/V5-His-TOPO) (Fu et al., 2012)
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
  • Vaccination Protocol: Four to five week old female BALB/c mice were divided randomly into three groups (30 mice per group): one group was injected intramuscularly in the hind thigh muscle with 100 μg of plasmid dissolved in 100 μl PBS; the other two groups were injected with pcDNA 3.1 vector only as negative control or PBS as blank control. Mice received a vaccination boost of an equivalent dose on day 14 and 28 following the first immunization (Fu et al., 2012).
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Although IgG analysis showed production of both IgG1 and IgG2, the higher levels of IgG1 indicated the dominance of Th2 response over Th1 response (Fu et al., 2012).
  • Challenge Protocol: Two weeks after the second vaccination boost, mice immunized with pCgap were divided into groups 1 and 2 (12 mice/group). The mice from group 1 were challenged intraperitoneally with a lethal dose of 3.0 × 109 CFU of H. parasuis SH0165 strain and the mice from group 2 were challenged intraperitoneally with a lethal dose of 3.0 × 109 CFU of H. parasuis MD0322 strain. Mice were monitored for seven days post-challenge, and morbidity and mortality were recorded (Fu et al., 2012).
  • Efficacy: The groups vaccinated with the pCgap vaccine exhibited 83.3% and 50% protective efficacy against the H. parasuis MD0322 serovar 4 or SH0165 serovar 5 challenges, respectively (Fu et al., 2012).
3. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine-Erysipelothrix Rhusiopathiae-Haemophilus Parasuis Bacterin (USDA: 49V9.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0004216
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
4. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine-Haemophilus Parasuis Bacterin (USDA: 49Q9.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0004218
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
IV. References
1. Barasuol et al., 2017: Barasuol BM, Guizzo JA, Fegan JE, Martínez-Martínez S, Rodríguez-Ferri EF, Gutiérrez-Martín CB, Kreutz LC, Schryvers AB, Frandoloso R. New insights about functional and cross-reactive properties of antibodies generated against recombinant TbpBs of Haemophilus parasuis. Scientific reports. 2017; 7(1); 10377. [PubMed: 28871190].
2. Fu et al., 2012: Fu S, Zhang M, Ou J, Liu H, Tan C, Liu J, Chen H, Bei W. Construction and immune effect of Haemophilus parasuis DNA vaccine encoding glyceraldehyde-3-phosphate dehydrogenase (GAPDH) in mice. Vaccine. 2012; 30(48); 6839-6844. [PubMed: 23000128].
3. Guo et al., 2017: Guo L, Xu L, Wu T, Fu S, Qiu Y, Hu CA, Ren X, Liu R, Ye M. Evaluation of recombinant protein superoxide dismutase of Haemophilus parasuis strain SH0165 as vaccine candidate in a mouse model. Canadian journal of microbiology. 2017; 63(4); 312-320. [PubMed: 28177794].
4. Hong et al., 2011: Hong M, Ahn J, Yoo S, Hong J, Lee E, Yoon I, Jung JK, Lee H. Identification of novel immunogenic proteins in pathogenic Haemophilus parasuis based on genome sequence analysis. Veterinary microbiology. 2011; 148(1); 89-92. [PubMed: 20817421].
5. Huang et al., 2013: Huang X, Li Y, Fu Y, Ji Y, Lian K, Zheng H, Wei J, Cai X, Zhu Q. Cross-protective efficacy of recombinant transferrin-binding protein A of Haemophilus parasuis in guinea pigs. Clinical and vaccine immunology : CVI. 2013; 20(6); 912-919. [PubMed: 23616407].
6. Li et al., 2015: Li M, Song S, Yang D, Li C, Li G. Identification of secreted proteins as novel antigenic vaccine candidates of Haemophilus parasuis serovar 5. Vaccine. 2015; 33(14); 1695-1701. [PubMed: 25704800].
7. Li et al., 2016: Li M, Li C, Song S, Kang H, Yang D, Li G. Development and antigenic characterization of three recombinant proteins with potential for Glässer's disease prevention. Vaccine. 2016; 34(19); 2251-2258. [PubMed: 26993332].
8. Li et al., 2017: Li M, Cai RJ, Song S, Jiang ZY, Li Y, Gou HC, Chu PP, Li CL, Qiu HJ. Evaluation of immunogenicity and protective efficacy of recombinant outer membrane proteins of Haemophilus parasuis serovar 5 in a murine model. PloS one. 2017; 12(4); e0176537. [PubMed: 28448603].
9. Macedo et al., 2016: Macedo N, Oliveira S, Torremorell M, Rovira A. Immune response to oligopeptide permease A (OppA) protein in pigs naturally and experimentally infected with Haemophilus parasuis. Research in veterinary science. 2016; 107; 62-67. [PubMed: 27473976].
10. Oliveira and Pijoan, 2004: Oliveira S, Pijoan C. Haemophilus parasuis: new trends on diagnosis, epidemiology and control. Veterinary microbiology. 2004; 99(1); 1-12. [PubMed: 15019107].
11. Olvera et al., 2011: Olvera A, Pina S, Pérez-Simó M, Aragón V, Segalés J, Bensaid A. Immunogenicity and protection against Haemophilus parasuis infection after vaccination with recombinant virulence associated trimeric autotransporters (VtaA). Vaccine. 2011; 29(15); 2797-2802. [PubMed: 21320547].
12. Tian et al., 2011: Tian H, Fu F, Li X, Chen X, Wang W, Lang Y, Cong F, Liu C, Tong G, Li X. Identification of the immunogenic outer membrane protein A antigen of Haemophilus parasuis by a proteomics approach and passive immunization with monoclonal antibodies in mice. Clinical and vaccine immunology : CVI. 2011; 18(10); 1695-1701. [PubMed: 21832103].
13. Wen et al., 2016: Wen Y, Yan X, Wen Y, Cao S, He L, Ding L, Zhang L, Zhou P, Huang X, Wu R, Wen X. Immunogenicity of the recombinant HxuCBA proteins encoded by hxuCBA gene cluster of Haemophilus parasuis in mice. Gene. 2016; 591(2); 478-483. [PubMed: 27378742].
14. Yuan et al., 2012: Yuan F, Fu S, Hu J, Li J, Chang H, Hu L, Chen H, Tian Y, Bei W. Evaluation of recombinant proteins of Haemophilus parasuis strain SH0165 as vaccine candidates in a mouse model. Research in veterinary science. 2012; 93(1); 51-56. [PubMed: 21596404].
15. Zhou et al., 2009: Zhou M, Guo Y, Zhao J, Hu Q, Hu Y, Zhang A, Chen H, Jin M. Identification and characterization of novel immunogenic outer membrane proteins of Haemophilus parasuis serovar 5. Vaccine. 2009; 27(38); 5271-5277. [PubMed: 19576561].