VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Haemophilus parasuis

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. gapA (Protective antigen)
  3. Vaccine Information
    1. Haemophilus Parasuis Avirulent Live Culture Vaccine (USDA: 19J1.00)
    2. pCgap DNA vaccine encoding glyceraldehyde-3-phosphate dehydrogenase
    3. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine-Erysipelothrix Rhusiopathiae-Haemophilus Parasuis Bacterin (USDA: 49V9.20)
    4. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine-Haemophilus Parasuis Bacterin (USDA: 49Q9.20)
  4. References
I. General Information
1. NCBI Taxonomy ID:
738
2. Disease:
Glasser's disease
3. Introduction
H. parasuis is a non-motile, small, pleomorphic rod in the family Pasteurellaceae, and is the etiologic agent of Glasser's disease. Glasser’s disease is characterized by fibrinous polyserositis, polyarthritis and meningitis. H. parasuis often produces acute septicemia, and its endotoxin induces disseminated intravascular coagulation, resulting in the formation of microthrombi in several organs (Oliveira and Pijoan, 2004).
4. Microbial Pathogenesis
H. parasuis colonizes the respiratory tracts of pigs, and can then cause systemic infection (Oliveira and Pijoan, 2004).
5. Host Ranges and Animal Models
Pigs
6. Host Protective Immunity
Early colonized pigs are protected against systemic infection by maternal antibodies. As maternal immunity decreases, these pigs are able to mount an active immune response to these virulent strains (Oliveira and Pijoan, 2004).
1. gapA
  • Gene Name : gapA
  • Sequence Strain (Species/Organism) : Haemophilus parasuis SH0165
  • NCBI Gene ID : 7278596
  • NCBI Protein GI : 219870280
  • Locus Tag : HAPS_0001
  • Genbank Accession : CP001321
  • Protein Accession : YP_002474655
  • Taxonomy ID : 557723
  • Gene Starting Position : 1
  • Gene Ending Position : 1020
  • Gene Strand (Orientation) : +
  • Protein Name : glyceraldehyde-3-phosphate dehydrogenase
  • Protein pI : 6.07
  • Protein Weight : 32717.08
  • Protein Length : 339
  • Protein Note : COG:G;COG0057
  • DNA Sequence : Show Sequence
    >gi|219870279:1-1020 Haemophilus parasuis SH0165 chromosome, complete genome
    TATGGCAATTAAAATTGGTATTAACGGCTTTGGCCGTATCGGTCGTATCGTATTCCGTGCAGCACAAAAA
    CGTGATGACATCGAAGTAGTTGGTATCAACGACTTAATTGATGTTGAGTATATGGCATATATGCTCAAAT
    ACGATTCAACTCACGGTCGTTTCGATGGCACTGTCGAAGTAAAAGACGGCAAATTAGTTGTAAACGGTAA
    AGAAATCCGTGTTACTTCTGAGCGTGACCCAGCTAACTTAAAATGGAATGAAATTGGTGTGGATATCGCA
    GTTGAAGCAACAGGTTTATTCTTGGACGATACAACTGCTCGTAAACACATCGAAGCTGGTGCGAAAAAAG
    TCGTTTTAACTGGTCCATCTAAAGATAGCACACCTATGTTCGTAAACGGTGTAAACTTCAACGCTTATGC
    TGGTCAAGACATCGTTTCTAACGCTTCTTGTACAACAAACTGCTTAGCACCACTTGCTCGTGTTATCCAC
    GAAACATTTGGTATCAAAGAAGGTTTAATGACAACTGTTCATGCAACAACAGCAACACAAAAAACTGTTG
    ATGGTCCATCAGCAAAAGACTGGCGCGGTGGTCGTGGTGCGGCACAAAACATCATTCCATCTTCAACAGG
    TGCAGCGAAAGCAGTAGGTAAAGTATTACCAGCATTAAACGGTAAATTAACAGGTATGGCGTTCCGTGTT
    CCAACAGCAAACGTATCTGTTGTTGATTTAACTGTAAACTTAGAAAAACCAGCAAGCTACGAAGAGATCA
    AAAAAGCGATCAAAGATGCAGCAGAAGGTAAAACATTCAACGGCGAATTAAAAGGCGTTTTAGGTTATAC
    TGAAGATGCAGTAGTATCAACAGACTTCAACGGTGCAGTTGAAACTTCTGTATTTGATGCAGATGCAGGT
    ATCGCATTAACAGATACATTCGTGAAACTTGTTTCTTGGTATGACAACGAAACTGGTTACTCAAACAAAG
    TATTAGACTTAGTTGCTCACGTTTACAACTACAAAGGCTA
  • Protein Sequence : Show Sequence
    >gi|219870280|ref|YP_002474655.1| glyceraldehyde-3-phosphate dehydrogenase [Haemophilus parasuis SH0165]
    MAIKIGINGFGRIGRIVFRAAQKRDDIEVVGINDLIDVEYMAYMLKYDSTHGRFDGTVEVKDGKLVVNGK
    EIRVTSERDPANLKWNEIGVDIAVEATGLFLDDTTARKHIEAGAKKVVLTGPSKDSTPMFVNGVNFNAYA
    GQDIVSNASCTTNCLAPLARVIHETFGIKEGLMTTVHATTATQKTVDGPSAKDWRGGRGAAQNIIPSSTG
    AAKAVGKVLPALNGKLTGMAFRVPTANVSVVDLTVNLEKPASYEEIKKAIKDAAEGKTFNGELKGVLGYT
    EDAVVSTDFNGAVETSVFDADAGIALTDTFVKLVSWYDNETGYSNKVLDLVAHVYNYKG
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Haemophilus Parasuis Avirulent Live Culture Vaccine (USDA: 19J1.00) , pCgap DNA vaccine encoding glyceraldehyde-3-phosphate dehydrogenase
III. Vaccine Information
1. Haemophilus Parasuis Avirulent Live Culture Vaccine (USDA: 19J1.00)
a. Manufacturer:
Newport Laboratories, Inc.
b. Vaccine Ontology ID:
VO_0001794
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
g. Gene Engineering of gapA
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
2. pCgap DNA vaccine encoding glyceraldehyde-3-phosphate dehydrogenase
a. Vaccine Ontology ID:
VO_0004515
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of gapA
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
pcDNA3.1 Directional TOPO vector (pcDNA3.1D/V5-His-TOPO) (Fu et al., 2012)
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
  • Vaccination Protocol: Four to five week old female BALB/c mice were divided randomly into three groups (30 mice per group): one group was injected intramuscularly in the hind thigh muscle with 100 μg of plasmid dissolved in 100 μl PBS; the other two groups were injected with pcDNA 3.1 vector only as negative control or PBS as blank control. Mice received a vaccination boost of an equivalent dose on day 14 and 28 following the first immunization (Fu et al., 2012).
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Although IgG analysis showed production of both IgG1 and IgG2, the higher levels of IgG1 indicated the dominance of Th2 response over Th1 response (Fu et al., 2012).
  • Challenge Protocol: Two weeks after the second vaccination boost, mice immunized with pCgap were divided into groups 1 and 2 (12 mice/group). The mice from group 1 were challenged intraperitoneally with a lethal dose of 3.0 × 109 CFU of H. parasuis SH0165 strain and the mice from group 2 were challenged intraperitoneally with a lethal dose of 3.0 × 109 CFU of H. parasuis MD0322 strain. Mice were monitored for seven days post-challenge, and morbidity and mortality were recorded (Fu et al., 2012).
  • Efficacy: The groups vaccinated with the pCgap vaccine exhibited 83.3% and 50% protective efficacy against the H. parasuis MD0322 serovar 4 or SH0165 serovar 5 challenges, respectively (Fu et al., 2012).
3. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine-Erysipelothrix Rhusiopathiae-Haemophilus Parasuis Bacterin (USDA: 49V9.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0004216
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
4. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine-Haemophilus Parasuis Bacterin (USDA: 49Q9.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0004218
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
IV. References
1. Fu et al., 2012: Fu S, Zhang M, Ou J, Liu H, Tan C, Liu J, Chen H, Bei W. Construction and immune effect of Haemophilus parasuis DNA vaccine encoding glyceraldehyde-3-phosphate dehydrogenase (GAPDH) in mice. Vaccine. 2012; 30(48); 6839-6844. [PubMed: 23000128].
2. Oliveira and Pijoan, 2004: Oliveira S, Pijoan C. Haemophilus parasuis: new trends on diagnosis, epidemiology and control. Veterinary microbiology. 2004; 99(1); 1-12. [PubMed: 15019107].