VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Mannheimia haemolytica

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. aroA (Virmugen)
  3. Vaccine Information
    1. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.20)
    2. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.21)
    3. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 4109.20)
    4. Bovine Rhinotracheitis-Parainfluenza 3 Killed Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin (USDA: 4265.00)
    5. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 43S5.20)
    6. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 43T5.20)
    7. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Mannheimia Haemolytica Bacterin (USDA: 44A5.20)
    8. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica Bacterin (USDA: 4477.20)
    9. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.20)
    10. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.21)
    11. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.20)
    12. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.21)
    13. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus-Mannheimia Haemolytica-Pasteurella Multocida Modified Live Virus, Avirulent Live Culture Vaccine (USDA: 11A8.22)
    14. Bovine Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 4C95.20)
    15. Mannheimia haemolytica aroA mutant vaccine
    16. Mannheimia Haemolytica-Pasteurella Multocida Avirulent Live Culture Vaccine (USDA: 1861.01)
  4. References
I. General Information
1. NCBI Taxonomy ID:
75985
2. Disease:
Bovine Respiratory Disease
3. Introduction
Mannheimia haemolytica is the principal bacterium isolated from respiratory disease in feedlot cattle and is a significant component of enzootic pneumonia in all neonatal calves. A commensal of the nasopharynx, M. haemolytica is an opportunist, gaining access to the lungs when host defenses are compromised by stress or infection with respiratory viruses or mycoplasma (Rice et al., 2007).
1. aroA
  • Gene Name : aroA
  • Sequence Strain (Species/Organism) : M. haemolytica NADC-D60
  • NCBI Protein GI : 451485
  • Other Database IDs : CDD:179423
    CDD:30129
  • Taxonomy ID : 75985
  • Gene Strand (Orientation) : ?
  • Protein Name : 5-enolpyruvylshikimate 3-phosphate synthase
  • Protein Length : 434
  • Protein Note : 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional
  • Protein Sequence : Show Sequence
    >gi|451485|gb|AAA21529.1| 5-enolpyruvylshikimate 3-phosphate synthase [Mannheimia haemolytica]
    MEKLTLTPISRVEGEINLPGSKSLSNRALLLAALATGTTQVTNLLDSDDIRHMLNALKALGVKYELSDDK
    TVCVLEGIGGAFKVQNGLSLFLGNAGTAMRPLAAALCLKGEEKSQIILTGEPRMKERPIKHLVDALRQVG
    AEVQYLENEGYPPLAISNSVCRGGKVQIDGSISSQFLTALLMSAPLAEGDMEIEIIGDLVSKPYIDITLS
    MMNDFGITVENRDYKTFLVKGKQGYVAPQGNYLVEGDASSASYFLASGAIKAGKVTGIGKKSIQGDRLFA
    DVLEKMGAKITWGEDFIQAEQSPLKGVDMDMNHIPDAAMTIATTALFAEGETVIRNIYNWRVKETDRLTA
    MATELRKVGAEVEEGEEGEDFIRIQPLALENFQHAEIETYNDHRMAMCFSLIALSNTEVTILDPNCTAKT
    FPTYFRDLEKLSVR
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An aroA mutant is highly attenuated in mice and induced significant protection after two doses from challenge with wild type M. haemolytica (Homchampa et al., 1994).
  • Related Vaccine(s): Mannheimia haemolytica aroA mutant vaccine
III. Vaccine Information
1. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.20)
a. Manufacturer:
Texas Vet Lab, Inc.
b. Vaccine Ontology ID:
VO_0001877
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
2. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.21)
a. Manufacturer:
Texas Vet Lab, Inc.
b. Vaccine Ontology ID:
VO_0001878
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
3. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 4109.20)
a. Manufacturer:
Texas Vet Lab, Inc.
b. Vaccine Ontology ID:
VO_0001879
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
4. Bovine Rhinotracheitis-Parainfluenza 3 Killed Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin (USDA: 4265.00)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0001885
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
5. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 43S5.20)
a. Manufacturer:
Texas Vet Lab, Inc.
b. Vaccine Ontology ID:
VO_0001905
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
6. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 43T5.20)
a. Manufacturer:
Texas Vet Lab, Inc.
b. Vaccine Ontology ID:
VO_0001906
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
7. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Mannheimia Haemolytica Bacterin (USDA: 44A5.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001938
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
8. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica Bacterin (USDA: 4477.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001961
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
9. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002004
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
10. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002005
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
11. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002006
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
12. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.21)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002007
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
13. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus-Mannheimia Haemolytica-Pasteurella Multocida Modified Live Virus, Avirulent Live Culture Vaccine (USDA: 11A8.22)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002008
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
14. Bovine Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 4C95.20)
a. Manufacturer:
Texas Vet Lab, Inc.
b. Vaccine Ontology ID:
VO_0002024
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
15. Mannheimia haemolytica aroA mutant vaccine
a. Vaccine Ontology ID:
VO_0002856
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of aroA
f. Immunization Route
Intraperitoneal injection (i.p.)
g. Mouse Response
16. Mannheimia Haemolytica-Pasteurella Multocida Avirulent Live Culture Vaccine (USDA: 1861.01)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002029
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
IV. References
1. Homchampa et al., 1994: Homchampa P, Strugnell RA, Adler B. Construction and vaccine potential of an aroA mutant of Pasteurella haemolytica. Veterinary microbiology. 1994; 42(1); 35-44. [PubMed: 7839583].
2. Rice et al., 2007: Rice JA, Carrasco-Medina L, Hodgins DC, Shewen PE. Mannheimia haemolytica and bovine respiratory disease. Animal health research reviews / Conference of Research Workers in Animal Diseases. 2007; 8(2); 117-128. [PubMed: 18218156].