VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Porcine respiratory and reproductive syndrome virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
    5. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. IFNG (Other)
    2. GP5 from CH-1a (Protective antigen)
    3. GP5 from YA1 (Protective antigen)
    4. ORF7 (Protective antigen)
    5. ubiquitin (Protective antigen)
    6. GP5 protein (Virmugen)
  3. Vaccine Information
    1. Porcine Reproductive & Respiratory Syndrome Reproductive & Respiratory Form, Modified Live Virus Vaccine (USDA: 19T1.20)
    2. Porcine Reproductive & Respiratory Syndrome Reproductive & Respiratory Form, Modified Live Virus Vaccine (USDA: 19T1.21)
    3. Porcine Reproductive & Respiratory Syndrome Reproductive Form, Killed Virus Vaccine (USDA: 19S5.20)
    4. Porcine Reproductive & Respiratory Syndrome Reproductive Form, Modified Live Virus Vaccine (USDA: 19Q1.20)
    5. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine (USDA: 19S1.20)
    6. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine (USDA: 19S1.21)
    7. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine-Erysipelothrix Rhusiopathiae-Haemophilus Parasuis Bacterin (USDA: 49V9.20)
    8. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine-Haemophilus Parasuis Bacterin (USDA: 49Q9.20)
    9. Porcine Reproductive & Respiratory Syndrome-Circovirus Reproductive & Respiratory Form, Type 2, Modifed Live Virus,Killed Baculovirus Vector Vaccine-Mycoplasma Hyopneumoniae Bacterin (USDA: 49K9.R0)
    10. Porcine Reproductive & Respiratory Syndrome-Parvovirus Reproductive Form, Modified Live & Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4P19.20)
    11. Porcine respiratory and reproductive syndrome virus GP5 protein mutant vaccine
    12. PRRSV DNA vaccine GST-ORF5 encoding GP5
    13. PRRSV DNA vaccine pCA-U-optiGP5
    14. PRRSV DNA vaccine pCI-ORF5/ORF6
    15. PRRSV DNA vaccine pIRESorf5/IFNγ
    16. PRRSV DNA vaccine pIRESorf5/IL-2
    17. PRRSV DNA vaccine pIRESorf7/IL-2
  4. References
I. General Information
1. NCBI Taxonomy ID:
28344
2. Disease:
Porcine Reproductive and Respiratory Syndrome (PRRS), Blue-Ear Pig Disease
3. Introduction
The PRRSV is an enveloped, single-stranded positive-sense RNA virus, approximately 50–65 nm in diameter that is classified in the order Nidovirales, family Arteriviridae, genus Arterivirus along with equine arteritis virus, lactate dehydrogenase-elevating virus of mice, and simian hemorrhagic fever virus. Properties of these viruses include the ability to induce prolonged viremia, persistent infections, and replication in macrophages. Being an enveloped virus, PRRSV survivability outside of the host is affected by temperature, pH and exposure to detergents. It is known that PRRSV can survive for extended intervals (>4 months) at temperatures ranging from −70 to −20 °C; however, viability decreases with increasing temperature. Regarding genetic diversity, there are two major prototypes of PRRSV, the European isolate (Lelystad virus, LV) and the North American isolate (VR-2332). Porcine reproductive and respiratory syndrome (PRRS) is an economically important disease of swine, estimated to cost the swine industry in USA approximately US$ 560 million per year. Clinical outbreaks of PRRS were first reported in the late 1980's in the USA; however, the etiology of the disease remained unknown. Clinical signs included severe reproductive failure, post-weaning pneumonia, growth reduction, decreased performance, and increased mortality. Similar clinical outbreaks were reported in Germany in 1990 and were widespread throughout Europe by 1991. In 1991, the etiologic agent, porcine reproductive and respiratory syndrome virus (PRRSV) was identified by investigators in The Netherlands and USA. Today, PRRSV is endemic in the global swine population; however, several countries, including Sweden, Switzerland, New Zealand, and Australia claim to be free of the disease (Cho and Dee, 2006).
4. Host Ranges and Animal Models
Pigs
5. Host Protective Immunity
Infected pigs develop a strong and rapid humoral response but these initial antibodies do not confer protection and can even be harmful by mediating an antibody-dependent enhancement of disease. In contrast, development of neutralising antibodies (NAs) is delayed and generation of cell-mediated immune responses, such as PRRSV-specific interferon (IFN)-gamma secreting cells, is initially erratic. In spite of this, induction of strong and rapid NAs and IFN-gamma responses seem to be required for effective vaccination. PRRSV strongly modulates the host's immune responses. The virus inhibits key cytokines, such as IFN-alpha, and may induce regulatory cytokines, such as interleukin (IL)-10 (Mateu and Diaz, 2008).
1. GP5 from CH-1a
  • Gene Name : GP5 from CH-1a
  • Sequence Strain (Species/Organism) : Porcine reproductive and respiratory syndrome virus
  • NCBI Protein GI : 14250961
  • Other Database IDs : CDD:109986
  • Taxonomy ID : 28344
  • Gene Strand (Orientation) : ?
  • Protein Name : GP5 envelope protein
  • Protein Length : 200
  • Protein Note : genotype: North America
  • Protein Sequence : Show Sequence
    >gi|14250961|gb|AAK44216.1| GP5 envelope protein [Porcine reproductive and respiratory syndrome virus]
    MLGKCLTTGCCSRLLSLWCIVPFCFAVLVNANSNSSSHFQLIYNLTLCELNGTDWLANKFDWAVETFVIF
    PVLTHIVSYGALTTSHFLDTVGLVTVSTAGFYHGRYVLSSIYAVCALAALICFVIRLAKNCMSWRYSCTR
    YTNFLLDTKGRLYRWRSPVIVEKGGKVEVEGHLIDLKRVVLDGSVATPLTRVSAEQWGRL
  • Molecule Role : Protective antigen
  • Related Vaccine(s): PRRSV DNA vaccine pCA-U-optiGP5 , PRRSV DNA vaccine pIRESorf5/IFNγ , PRRSV DNA vaccine pIRESorf5/IL-2
2. GP5 from YA1
  • Gene Name : GP5 from YA1
  • Sequence Strain (Species/Organism) : Porcine reproductive and respiratory syndrome virus YA1
  • NCBI Protein GI : 71152867
  • Other Database IDs : CDD:109986
  • Taxonomy ID : 28344
  • Gene Strand (Orientation) : ?
  • Protein Name : major envelope glycoprotein
  • Protein Length : 200
  • Protein Note : Arterivirus GL envelope glycoprotein; pfam00951
  • Protein Sequence : Show Sequence
    >gi|71152867|gb|AAZ29507.1| major envelope glycoprotein [Porcine reproductive and respiratory syndrome virus]
    MLGKCLTTGCCSRLLSLWCIVPFCFAVLVNANSNSSSHFQLIYNLTLCELNGTDWLANKFDWPVETFVIF
    PVLTHIVSYGALTTSHFLDTVGLVTVSTAGFYHGRYVLSSIYAVCALAALNCFVIRLAKNCISWRYSCTR
    YTNFLLDPKGRLYRWRSPVIVEEGGKVEVEGHLIDLKRVVLDGSVATPLTRDSAEQWGRL
  • Molecule Role : Protective antigen
  • Related Vaccine(s): PRRSV DNA vaccine pCI-ORF5/ORF6
3. GP5 protein
  • Gene Name : GP5 protein
  • Sequence Strain (Species/Organism) : Porcine reproductive and respiratory syndrome virus strain HUN4
  • NCBI Protein GI : 149389584
  • Other Database IDs : CDD:109986
  • Taxonomy ID : 28344
  • Gene Strand (Orientation) : ?
  • Protein Name : GP5
  • Protein Length : 200
  • Protein Note : genotype: North American
  • Protein Sequence : Show Sequence
    >gi|149389584|gb|ABR26253.1| GP5 [Porcine reproductive and respiratory syndrome virus]
    MLGKCLTACCCSRLLFLWCIVPFYLAVLVNASNNNSSHIQLIYNLTLCELNGTDWLAQKFDWAVETFVIF
    PVLTHIVSYGALTTSHFLDTVGLATVSTAGYYHGRYVLSSIYAVCALAALICFVIRLAKNCMSWRYSCTR
    YTNFLLDTKGRLYRWRSPVIVEKGGKVEVEGHLIDLKRVVLDGSAATPLTRVSAEQWGRL
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A mutation in the GP5 protein attenuates HP-PRRSV in piglets. This mutant (HuN4-F112) induces protection against challenge with wild type HP-PRRSV (Tian et al., 2009).
  • Related Vaccine(s): Porcine respiratory and reproductive syndrome virus GP5 protein mutant vaccine , PRRSV DNA vaccine GST-ORF5 encoding GP5
4. IFNG
  • Gene Name : IFNG
  • Sequence Strain (Species/Organism) : Sus scrofa
  • NCBI Gene ID : 396991
  • NCBI Protein GI : 47522726
  • Genbank Accession : CU694828
  • Protein Accession : NP_999113
  • Taxonomy ID : 9823
  • Chromosome No : 5
  • Gene Starting Position : 35374420
  • Gene Ending Position : 35379184
  • Gene Strand (Orientation) : +
  • Protein Name : interferon, gamma
  • Protein pI : 10.07
  • Protein Weight : 18822.46
  • Protein Length : 166
  • DNA Sequence : Show Sequence
    >gi|347618789:35374420-35379184 Sus scrofa breed mixed chromosome 5, Sscrofa10.2
    CCAGAAGCTAACTCTCTCCGAAACAATGAGTTATACAACTTATTTCTTAGCTTTTCAGCTTTGCGTGACT
    TTGTGTTTTTCTGGCTCTTACTGCCAGGCGCCCTTTTTTAAAGAAATAACGATCCTAAAGGACTATTTTG
    TAAGTATGACCTTTTAATAATACTTGCTTGTAGTTGAGTAGACTGATGCTGAATTGGAATTGTGTCTATG
    ATGGACTCTCGTCTCTAATCCACAAGTCATCTTGAGAAGACTTGGTGTTATGGTGACTGTTTGTTGGCTG
    GATGAGTTTTTTTGACTAGATGAGCTAGATATTTATTGTTTTAACCCTCTGTTCAATTTGCTATAGACAT
    TTAAGGGAGAGTTCATGAATCCTCCAAAAGATGAGCATAGTATGGGTATAAATCTTCGTGTTGAGAATCC
    ATTCAATTAGGATGTCTAGTAGTGAGTGTACTGAGAAAATGGGTATTAGTTTCTGACTTCTCAGGCTACT
    AGGACAGTGACAGTCAAAGGTCAATATTAGCATTAAAAATGGTTATGAAATAACTGATCAATTACAGAAG
    GTGAGGTCCTTAAAGCTTTGGCTTAAGAAATAATTTACAGGTATTTTTCTCTGAAAAGTAGTTTTAAAAT
    TCTTCTATTCCATCTATATTGTCTGTGAATTACTCTTGGACTCAGTCACTTGCTGAGATTTTTTTGTAGG
    AGTTATAATCTTATAGTTTTAAAATTGTTTTTGTTTTGTCTTATGAATTTCTTAATTTTTTCACTTACAG
    TTAATTAAAATAGTTTTTGCACTTAAAATATTTTACGTCCAAAATTTAGCTGTTATAATTATAGCTGGGG
    CAATTATAGTTGACACAATAACTTACAGGACATAGGTAGAGGTAATAGAAACCTTTACCATAGGGGGGCA
    GTGTTTTGTAGTGAGATGGCTTTGCTGATTTTTTTTTTTTCCCCTTTAAATTTGGCTTAAAAATATTTTC
    TTTTCCTTATTATACTTGTTTGGGACAATTGAAGTATCATCAGCCTTGTTGAGTTCATTTGTGATGTTTC
    AATTTAAGAGTTAATACTAGAAAATAAGAAAGCTAAAATAACATGATAGTCTTTGGCTATATCTAACATG
    ATGGTTTTTAAGAATACTTATTGATAGAACCAAACAGAGGGTGGAAGAGAAAATCAGTGGATATTGCTGG
    CATCTGAATTCAGTAAAACTTGAAGTACAGTTTTTAGGGCAATTTATGGACTATTTGTAAACTAATCCTC
    CCTCCCCCCCACCTTTTCCCCCCAGAATGCAAGTACCTCAGATGTACCTAATGGTGGACCTCTTTTCTTA
    GAAATTTTGAAGAATTGGAAAGAGGTAAGCTGAACATTTCTATTTGGCTGATTTTCCTGTTGCTTATTTT
    CTACTGGATAAATTCACATCACTCTCTCTTTGTGCTCTTTTCTCCCAAGGAGAGTGACAAAAAAATAATT
    CAGAGCCAAATTGTCTCCTTCTACTTCAAATTCTTTGAAATCTTCAAAGATAACCAGGCCATTCAAAGGA
    GCATGGATGTGATCAAGCAAGACATGTTTCAGAGGTTCCTAAATGGTAGCTCTGGGAAACTGAATGACTT
    CGAAAAGCTGATTAAAATTCCGGTGAGATGAGCTTAATTCTTTTTTTGTTTCATTTGTAAAGGCTCTTGT
    AAAACACTTCATTCCAGTAAAAATGGAAATTAGTTACTGGATACAGTTGTTAAAGCTATGGAGTGAACCT
    GTAGTCAAAACTCCTCTTTGGTAATTATGTTTGTGCTTTGGGTGACTTGGTAAAGTCACTTATGGGAGTC
    ATTCACATTTGTGATTTGGGAAAAGGCTGGCATTATGCCTACCACACAAAGACAGGTGAATGAGCAAATC
    AGGGAGAAGGAAGTAGTGAAGAAGTTGAGGGCAGTGTTGGAAAGCAGTCCTCCCATTACCCCTTGTTTGT
    GTGTTGGAAATTCTCTTGTTTTGAATAGCAGGCTGCACTTGTTAATGGAAAGAACAGTGGGAGGGGTGGA
    GAAGATGTGAGCTCCTCCCAGTTCAAGCCACCAGAGACCTGTGTGACCACAGATGAATCACAGGCCTGGC
    TGGGGCTGTTTCCTCATCTTAAAAGGAGTCTGTTGGCTTCACTATAATTTATATGGTCTCCTTTGCTCTA
    AAGTCTGCAGTGCCATAGACAGAAAATGAGAATGAGATAGGAGGAAGGTATGACCTTGGAGGGGACAAGG
    GGCCTCCTTCTGCCAGACTCTGGTCATCCTCTCACATTGTACAGCCCAAGTAATGGCAGAATGTTAGTTT
    TTAGTAAAGAAAATAGGTAGAATTTATACCTTAGGAAAAAATTGTCCTATCCACTTTTGGATACCAGAGT
    ATTTCAGCTGGAGAAATTTTTAGGGTCCCAAACTTTATCTTATTAAATTGTCTTGTCTTTAAAGTTATGG
    TATCTAGAAGCTGAAAGATAACTTTGAAGCATAAAGACAAGTCATATTTTCAAAAATTTCATCTGAGAGA
    TGAAGGCCTTAAGACTTGGGGATGGGGGTGAGCTTTGATATAATAGGCTTGAATGAGAAGAGGAGGGGTT
    CCCGTTATGACTGTGCTCTTGGGATTTGTGCCCCAGCTCTCACTATAACTGGGTCTGCCTCTCACCAATC
    TCTCATAAGCTCCCAGAAACTGAACGAAGTGCTTGCTCTTCAAGATTTCTCTAGTCTTTGGTAGATTAAA
    TGGGACAAAAGTGGCTTGGAACAATTATAAGACCATTACTACTTCCACTGGTCATGTTTTGCAATGTCCA
    ACAGATCTCCATTGGCTGCAGGCTAGAAAATAAAAAAGCACTTGTTCCTAACCCAGGGCAGCCCTTGGCT
    TGCCATTCATGCTTTGAACCCTAGAAAGTAAAATTTATCACTTGCAAACACACAGCTGGTAGAAACTTTC
    CTATTTTGCTATAATTGGGCCTTGAAAAAAAAAATCTGTTGGTCCCATCTTCTAGAATCTCCAAGCCTCC
    TCCTTCATGATGGACAATCTTGAGTGGACTCTCAACCCTTGTCTTTTGCTCAGTTGCTAACATATTTAAG
    GCTAACGTAGGATCTCCTAGTCATTGTAAGAAATTGGCAAGGTGGCCACAGTATACGCAGCTTTAGAAAG
    AAATGTAGGAGTTCCTGTTGTGGTGCAGCAGAAACAAATACAACTAGGAACCATGAGGTTTCGGGTTCAA
    TCCCTGGCCTTGTTCAGTGGGTTAAGGATCTGGCATTGCCATGAGCTGTTGGTGTAGGTCGCAGATGTGG
    CTCGGATCTGGCATTGCTGTGGCTGTGGTGTAGGCTGGCAGCTGTGGCTCCAATTAGACCCCTAGCCTGG
    GAACCTCCATATGCCGTGGGTGTGGCCCTAAAAATACAAAACAAAAGAAAGAAAGAAAGAAGGTGAGAGA
    GAGAGAGAGAGAGAGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAAGAAAGAAATATAGTAGCAAA
    GCAAAGATGAAAATAAGTAGTCTTCATTTTATGAAACATAGATTCACCTAAATGGTCCTATTGGAGAACA
    GGACCAACTGAACAGTGAGAAAACAGTTCAATTTGCTGGAATGGAAGGCAGGGTGTAGGGAAATTTGCTT
    TCATTCCTAAAGTGTTACATACCAGCAATTGATTATTGCATATAAATATGATCAGTATTTATTTTTAATT
    GCATTATGGAAATGATAAGACTGACCTAATTTGGGAGAAATTAAAAATGATGTTTTTCATCTGCCTTGGA
    CTTGGTGTTTACGAAGTACTGAATCTATACCAGTGGTTCTCAAACTTTGGTGGTGTCTGAATCATCTGGT
    GATGTTAATAACTATGCAGTGGCCCAGGCCCAGTCCAATTTCATGCCTCTGGGTCTCTGAGTGTTTCATT
    AGGTCTCCAGGTTATTCTGCTGCATGCCAAAATTGAGCGCCATTGCCTACAGTAACTCGTTTGATGCTTA
    TGGCACAGACTGCATACAAAGTGATAGAAGTGGTAGAGAACCTGGAGGTCATCTGAACAACCTCCTCATT
    GTTTAGAGGAAAAAACAGAGATTTGGAGAGGTTAAGGGACTGGTTTAAAGTTAGATGTATTGCACACACA
    GAATTCAAACTCACATTTCTTGGTCCCTCACTCTACTTCGGGGCTCTTTTCACTATATAATTTTCAGCAT
    TCCATAGCAGTAAATTTAAGGATATGTGATGTCTCCCATGATGTAACAGCACAACTAGCAATTTAATTAT
    AATTTTAGTCTTAATTAATGAAGAAATCAACATCTCATATTAAGCTAATGTATTGCTAGTGAAAATAATT
    TATTTTAAAGGAATACTTCCACTTTTATGGACCATGACAGCAGAATATCCTGATGGCTCATATGCCTGAA
    ATTAATTTTGCTGTTTTCTCTCCCAACAGGTAGATAATCTGCAGATCCAGCGCAAAGCCATCAGTGAACT
    CATCAAAGTGATGAATGATCTGTCACCAAGATCTAACCTAAGAAAGCGGAAGAGAAGTCAGACTATGTTC
    CAAGGCCAGAGAGCATCAAAATAATTGTCATCCTGCCTGCAATATTTGAATTTTTAAATCTCAATCTATT
    TATTAATATTTAATATTTTACATTATTTATATGGGGAATATTGATTCATTGATCAAAGTATTTATAATGT
    AACTTTTATGTGATGAAAATGGGTATCTATTAACATATGTGTTATTTATGATTCCTGTATCCTGTGACTA
    TTTCA
  • Protein Sequence : Show Sequence
    >gi|47522726|ref|NP_999113.1| interferon gamma precursor [Sus scrofa]
    MSYTTYFLAFQLCVTLCFSGSYCQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQS
    QIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVM
    NDLSPRSNLRKRKRSQTMFQGQRASK
  • Molecule Role : Other
  • Related Vaccine(s): PRRSV DNA vaccine pIRESorf5/IFNγ
5. ORF7
  • Gene Name : ORF7
  • Sequence Strain (Species/Organism) : Porcine reproductive and respiratory syndrome virus CH-1a
  • NCBI Protein GI : 14250964
  • Other Database IDs : CDD:110480
  • Taxonomy ID : 28344
  • Gene Strand (Orientation) : ?
  • Protein Name : nucleocapsid protein
  • Protein Length : 123
  • Protein Note : genotype: North America
  • Protein Sequence : Show Sequence
    >gi|14250964|gb|AAC15449.2| nucleocapsid protein [Porcine reproductive and respiratory syndrome virus]
    MPNNNGKQRKKKKGNGQPVNQLCQMLGKIIAQQNQSRGKGPGKKNKKKSPEKPHFPLATEDDVRHHFTPS
    ERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA
  • Molecule Role : Protective antigen
  • Related Vaccine(s): PRRSV DNA vaccine pIRESorf7/IL-2
6. ubiquitin
  • Gene Name : ubiquitin
  • Sequence Strain (Species/Organism) : Sus scrofa
  • NCBI Nucleotide GI : 164707
  • NCBI Protein GI : 164708
  • Protein Accession : AAA31133.1
  • Taxonomy ID : 9823
  • Gene Strand (Orientation) : ?
  • Protein Name : Ub mRNA
  • Protein Note : poly-ubiquitin precursor
  • DNA Sequence : Show Sequence
    >gi|164707|gb|M18159.1|PIGUBP Pig poly-ubiquitin mRNA, 3' end
    GAAGATGGGCGCACCCTGTCTGACTACAACATCCAGAAGGAGTCCACCCTGCACCTGGTCCTCCGCCTCA
    GAGGTGGGATGCAGATCTTCGTGAAGACCTTGACTGGTAAGACCATCACCCTGGAAGTGGAGCCCAGCGA
    CACCATCGAGAATGTCAAGGCGAAGATCCAAGACAAGGAAGGCATCCCCCCAGACCAGCAGAGGCTGATC
    TTTGCCGGGAAGCAGCTGGAAGATGGGCGCACCCTGTCTGACTACAACATCCAGAAGGAGTCCACCCTGC
    ACCTGGTCCTCCGCCTCAGAGGTGGGATGCAGATCTTCGTGAAGACCTTGACTGGTAAGACCATCACCCT
    GGAAGTGGAGCCCAGCGACACCATCGAGAATGTCAAGGCGAAGATCCAAGACAAGGAAGGCATCCCCCCA
    GACCAGCAGAGGCTGATCTTTGCCGGGAAGCAGCTGGAAGATGGGCGCACCCTGTCTGACTACAACATCC
    AGAAGGAGTCCACCCTGCACCTGGTCCTCCGCCTCAGAGGTGGGATGCAGATCTTCGTGAAGACCTTGAC
    TGGTAAGACCATCACCCTGGAAGTGGAGCCCAGCGACACCATCGAGAACGTCAAGGCGAAGATCCAGGAC
    AAGGAAGGCATCCCCCCAGACCAGCAGAGGCTGATCTTTGCCGGGAAGCAGCTGGAAGATGGGCGCACCC
    TGTCTGACTACAACATCCAGAAGGAGTCCACCCTGCACTTGGTCCTGCGCTTGAGGGGAGGTTTCTAAGT
    TCTCCCTTTTAAGCTTTCAACAAATTTCATTGCACTTTTCTTTCAATAAAGTTGTTGCATTC
  • Molecule Role : Protective antigen
  • Related Vaccine(s): PRRSV DNA vaccine pCA-U-optiGP5
III. Vaccine Information
1. Porcine Reproductive & Respiratory Syndrome Reproductive & Respiratory Form, Modified Live Virus Vaccine (USDA: 19T1.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc.
b. Vaccine Ontology ID:
VO_0001799
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
2. Porcine Reproductive & Respiratory Syndrome Reproductive & Respiratory Form, Modified Live Virus Vaccine (USDA: 19T1.21)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0001800
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
3. Porcine Reproductive & Respiratory Syndrome Reproductive Form, Killed Virus Vaccine (USDA: 19S5.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001801
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
4. Porcine Reproductive & Respiratory Syndrome Reproductive Form, Modified Live Virus Vaccine (USDA: 19Q1.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001802
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
5. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine (USDA: 19S1.20)
a. Manufacturer:
Wyeth, Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0001803
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
6. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine (USDA: 19S1.21)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0001804
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
7. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine-Erysipelothrix Rhusiopathiae-Haemophilus Parasuis Bacterin (USDA: 49V9.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0004214
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
8. Porcine Reproductive & Respiratory Syndrome Respiratory Form, Modified Live Virus Vaccine-Haemophilus Parasuis Bacterin (USDA: 49Q9.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0004217
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
9. Porcine Reproductive & Respiratory Syndrome-Circovirus Reproductive & Respiratory Form, Type 2, Modifed Live Virus,Killed Baculovirus Vector Vaccine-Mycoplasma Hyopneumoniae Bacterin (USDA: 49K9.R0)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002317
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
10. Porcine Reproductive & Respiratory Syndrome-Parvovirus Reproductive Form, Modified Live & Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4P19.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002324
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
11. Porcine respiratory and reproductive syndrome virus GP5 protein mutant vaccine
a. Product Name:
HuN4-F112
b. Vaccine Ontology ID:
VO_0002982
c. Type:
Live, attenuated vaccine
d. Status:
Research
e. Host Species as Laboratory Animal Model:
Pig
f. Gene Engineering of GP5 protein
  • Type: Gene mutation
  • Description: This GP5 protein mutant is from Porcine reproductive and respiratory syndrome virus (Tian et al., 2009).
  • Detailed Gene Information: Click here.
g. Immunization Route
Intramuscular injection (i.m.)
h. Pig Response
  • Persistence: A GP5 protein mutant is attenuated in piglets (Tian et al., 2009).
  • Efficacy: A GP5 protein mutant induces protection in piglets from challenge with wild type HP-PRRSV (Tian et al., 2009).
12. PRRSV DNA vaccine GST-ORF5 encoding GP5
a. Vaccine Ontology ID:
VO_0004325
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig, mouse
e. Gene Engineering of GP5 protein
  • Type: DNA vaccine construction
  • Description: Vector pET21a expressed the major envelope glycoprotein (GP5) of porcine reproductive and respiratory syndrome virus (PRRSV) (Pirzadeh and Dea, 1998).
  • Detailed Gene Information: Click here.
f. Vector:
pET21a (Pirzadeh and Dea, 1998)
g. Immunization Route
Intramuscular injection (i.m.)
h. Pig Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Following a massive intratracheal challenge with the virulent IAF-Klop strain of PRRSV, DNA-vaccinated pigs were protected from generalized viraemia and the development of typical macroscopic lung lesions that were observed in unvaccinated, virus-challenged controls, as well as in pigs that were immunized with E. coli-expressed GST-ORF5 recombinant fusion protein (Pirzadeh and Dea, 1998).
13. PRRSV DNA vaccine pCA-U-optiGP5
a. Vaccine Ontology ID:
VO_0004506
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig
e. Gene Engineering of GP5 from CH-1a
  • Type: DNA vaccine construction
  • Description: Vector pCAGGS expressed the U-optiGP5 fusion gene was generated by linking optiGP5 downstream of ubiquitin. The Kozak sequence, GCCACC, served as the upstream start codon for all three fragments (Hou et al., 2008).
  • Detailed Gene Information: Click here.
f. Gene Engineering of ubiquitin
  • Type: DNA vaccine construction
  • Description: This vaccine expressed a sequence encoding pig ubiquitin that had its Gly76 changed to Ala76 (Hou et al., 2008).
  • Detailed Gene Information: Click here.
g. Vector:
pCAGGS (Hou et al., 2008)
h. Immunization Route
Intramuscular injection (i.m.)
i. Pig Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Four of six pigs in the pCA-U-optiGP5 group were devoid of visible pathological changes that were present in other vaccinated and control animals after challenge (Hou et al., 2008).
14. PRRSV DNA vaccine pCI-ORF5/ORF6
a. Vaccine Ontology ID:
VO_0004510
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse, pig
e. Gene Engineering of GP5 from YA1
  • Type: DNA vaccine construction
  • Description: Vector pCl-neo expressed GP5 (encoded by ORF5) and M (encoded by ORF6) (Jiang et al., 2006).
  • Detailed Gene Information: Click here.
f. Vector:
pCI-neo (Jiang et al., 2006)
g. Immunization Route
Intramuscular injection (i.m.)
h. Pig Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: All immunized piglets developed neutralizing antibodies at 10 weeks after primary immunization, whereas there was no detectable neutralizing antibodies in piglets immunized with pCI-ORF5. Neutralizing antibodies are considered to be important in protection against PRRSV (Jiang et al., 2006).
15. PRRSV DNA vaccine pIRESorf5/IFNγ
a. Vaccine Ontology ID:
VO_0004507
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig
e. Gene Engineering of GP5 from CH-1a
  • Type: DNA vaccine construction
  • Description: Vector pIRES1neo expressed GP5, encoded by ORF5, the major envelope protein of the virus harboring neutralizing epitopes (Xue et al., 2004).
  • Detailed Gene Information: Click here.
f. Vector:
pIRES1neo (CLONTECH) (Xue et al., 2004)
g. Immunization Route
Intramuscular injection (i.m.)
h. Pig Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: After immunization and viral challenge, two of three pigs immunized with pIRESorf5/IFNgamma were protected from lung lesions that were present in other vaccinated and control animals (Cho and Dee, 2006).
16. PRRSV DNA vaccine pIRESorf5/IL-2
a. Vaccine Ontology ID:
VO_0004508
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig
e. Gene Engineering of GP5 from CH-1a
  • Type: DNA vaccine construction
  • Description: Vector pIRES1neo expressed GP5, encoded by ORF5, the major envelope protein of the virus harboring neutralizing epitopes (Xue et al., 2004).
  • Detailed Gene Information: Click here.
f. Vector:
pIRES1neo (CLONTECH) (Xue et al., 2004)
g. Immunization Route
Intramuscular injection (i.m.)
h. Pig Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: After immunization and viral challenge, one of three pigs immunized with pIRESorf5/IL-2 was protected from lung lesions that were present in other vaccinated and control animals (Xue et al., 2004).
17. PRRSV DNA vaccine pIRESorf7/IL-2
a. Vaccine Ontology ID:
VO_0004509
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig
e. Gene Engineering of ORF7
  • Type: DNA vaccine construction
  • Description: Vector pIRES1neo expressed N, encoded by ORF7, which forms the nucleocapsid protein of the virus, and it is likely to contain virus-specific T cell epitopes (Xue et al., 2004).
  • Detailed Gene Information: Click here.
f. Vector:
pIRES1neo (Xue et al., 2004)
g. Immunization Route
Intramuscular injection (i.m.)
h. Pig Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: After immunization and viral challenge, one of three pigs immunized with pIRESorf7/IL-2 was protected from lung lesions that were present in other vaccinated and control animals (Xue et al., 2004).
IV. References
1. Cho and Dee, 2006: Cho JG, Dee SA. Porcine reproductive and respiratory syndrome virus. Theriogenology. 2006; 66(3); 655-662. [PubMed: 16730057].
2. Hou et al., 2008: Hou YH, Chen J, Tong GZ, Tian ZJ, Zhou YJ, Li GX, Li X, Peng JM, An TQ, Yang HC. A recombinant plasmid co-expressing swine ubiquitin and the GP5 encoding-gene of porcine reproductive and respiratory syndrome virus induces protective immunity in piglets. Vaccine. 2008; 26(11); 1438-1449. [PubMed: 18262692].
3. Jiang et al., 2006: Jiang Y, Xiao S, Fang L, Yu X, Song Y, Niu C, Chen H. DNA vaccines co-expressing GP5 and M proteins of porcine reproductive and respiratory syndrome virus (PRRSV) display enhanced immunogenicity. Vaccine. 2006; 24(15); 2869-2879. [PubMed: 16446016].
4. Mateu and Diaz, 2008: Mateu E, Diaz I. The challenge of PRRS immunology. Veterinary journal (London, England : 1997). 2008; 177(3); 345-351. [PubMed: 17644436].
5. Pirzadeh and Dea, 1998: Pirzadeh B, Dea S. Immune response in pigs vaccinated with plasmid DNA encoding ORF5 of porcine reproductive and respiratory syndrome virus. The Journal of general virology. 1998; 79 ( Pt 5); 989-999. [PubMed: 9603313].
6. Tian et al., 2009: Tian ZJ, An TQ, Zhou YJ, Peng JM, Hu SP, Wei TC, Jiang YF, Xiao Y, Tong GZ. An attenuated live vaccine based on highly pathogenic porcine reproductive and respiratory syndrome virus (HP-PRRSV) protects piglets against HP-PRRS. Veterinary microbiology. 2009; 138(1-2); 34-40. [PubMed: 19339125].
7. Xue et al., 2004: Xue Q, Zhao YG, Zhou YJ, Qiu HJ, Wang YF, Wu DL, Tian ZJ, Tong GZ. Immune responses of swine following DNA immunization with plasmids encoding porcine reproductive and respiratory syndrome virus ORFs 5 and 7, and porcine IL-2 and IFNgamma. Veterinary immunology and immunopathology. 2004; 102(3); 291-298. [PubMed: 15507312].