VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Porcine rotavirus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. VP2 (Protective antigen)
    2. VP7 (Protective antigen)
    3. VP8 (Protective antigen)
  3. Vaccine Information
    1. Porcine Rotavirus Modified Live Virus Vaccine (USDA: 19E1.20)
    2. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine (USDA: 19H1.20)
  4. References
I. General Information
1. NCBI Taxonomy ID:
10913
2. Disease:
Diarrhea
3. Introduction
Rotavirus is an important pathogen that causes diarrhea in human infants and in animals worldwide. Rotavirus infections in pigs seriously impact the pork industry. The mortality rate in piglets is extremely variable, ranging from 0 to 50%, and is usually of the order of 0–10%; however, the loss in growth in recovered piglets is economically the most important effect of the disease (Li et al., 2010).
4. Microbial Pathogenesis
Gut mucosal infection occurs primarily by the invasion route via viral replication at the tips of the villi of epithelial cells in the small intestine, leading to structural and functional changes in the epithelium. The diarrhea that results is caused by the multiple activities of the virus. Malabsorption is a generally accepted mechanism of rotavirus-induced diarrhea, which is characterized by viral replication in villus enterocytes in the small intestine, with subsequent cell lysis and attendant villus blunting, depressed level of mucosal disaccharidase, watery diarrhea, and dehydration. The rotavirus nonstructural protein NSP4, which has recently been suggested to have a toxin-like function, may participate in inducing intestinal inflammation (Li et al., 2010).
5. Host Ranges and Animal Models
Pigs
6. Host Protective Immunity
Because rotaviruses are enteric pathogens, gut mucosal immune responses are likely to play an important role in protective immunity against rotavirus infection. Gut innate immunity provides the first line of defense against pathogenic microorganisms and also initiates acquired immune responses (Li et al., 2010).
1. VP2
  • Gene Name : VP2
  • Sequence Strain (Species/Organism) : Porcine rotavirus
  • NCBI Protein GI : AJC68690
  • Other Database IDs : CDD:282884
  • Taxonomy ID : 10913
  • Protein Name : VP2 protein
  • Protein pI : 5.56
  • Protein Weight : 98671.47
  • Protein Length : 948
  • Protein Note : Rotavirus VP2 protein; pfam05087
  • Protein Sequence : Show Sequence
    >AJC68690.1 VP2 protein [Porcine rotavirus]
    MAYRKRGAKRENLPQQNERLQEKEIEKNIDASMESKANNKKQQLSDKVLSQKEEIITDAQDDVKIADEVK
    KSSKEESKQLLEILKTKEDHQKEVQYEILQKTIPTFEPKESILKKLEDMKPEQAKKQTKLFRIFEPKQLP
    IYRANGERELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQILIEMPDYLLLKDMAVENKNSRDAGKVVDS
    ETASICDAIFQDEETEGVIRRFIADMRQQVQADRNVVNYPSILHPIDHAFNEYFLNHQLVEPLNNEIIFN
    YIPERIRNDVNYILNMDMNLPSTARYIRPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKEKELV
    STEAQIQKMSQDLQLEALTIQSETQFLAGINSQAANDCFKTLIAAMLSQRTMSLEFVTTNYMSLISGMWL
    LTVIPNDMFLRESLVACELAIINTIVYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLHFINNNRF
    RQVVIDGVLNQTLNDNIRNGQVINQLMDALMQLSRQQFPTMPVDYKRSIQRGILLLSNRLGQLVDLTRLL
    SYNYEILMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNTTVIPSPQTLFHYYNVNVNFHSNYNERIND
    AVAIITAANRLNLYQKKMKSIVEEFLKRLQIFDVPRVPDDQMYRLRDRLRLLPVERRRLDIFNLILMNME
    QIERASDKIAQGVIIAYRDMQLERDEMYGYVNIARNLDGYQQINLEELMRTGDYGQITNMLLNNQPVALV
    GALPFVTDSSVISLIAKLDATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWIPTSTTKVYKQVP
    QPFDFRASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Wen et al., 2015)
2. VP7
  • Gene Name : VP7
  • Sequence Strain (Species/Organism) : Porcine rotavirus
  • NCBI Protein GI : AET79173
  • Other Database IDs : CDD:278842
  • Taxonomy ID : 10913
  • Protein Name : VP7 protein
  • Protein pI : 4.1
  • Protein Weight : 30057.77
  • Protein Length : 338
  • Protein Note : group: A; genotype: P8b
  • Protein Sequence : Show Sequence
    >AET79173.1 VP7 protein, partial [Porcine rotavirus]
    MYGIEYTTVLTFLISIVLLNYILKSLTSVMDFIIYRFLLLIVIVSPFVKTQNYGINLPITGSMDTAYANS
    SQQETFLTSTLCLYYPTEASTQIGDTEWKDTLSQLFLTKGWPTGSVYFKEYTDIASFSIDPQLYCDYNVV
    LMKYDSTLELDMSELADLILNEWLCNPMDITLYYYQQTNEANKWISMGQSCTIKVCPLNTQTLGIGCTTT
    NPTTFEEVAKNEKLVITDVVDGVNHKLDVTTNTCTIRNCKKLGPRENVAIIQVGGSEVLDITADPTTAPQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Hu and Wang, 2008)
3. VP8
  • Gene Name : VP8
  • Sequence Strain (Species/Organism) : Porcine rotavirus
  • NCBI Protein GI : AEU04135
  • Other Database IDs : CDD:189541
  • Taxonomy ID : 10967
  • Protein Name : VP8
  • Protein pI : 4.45
  • Protein Weight : 25305.87
  • Protein Length : 284
  • Protein Note : group: A; genotype: G3
  • Protein Sequence : Show Sequence
    >AEU04135.1 VP8 [Porcine rotavirus A]
    MASLIYRQLLSNSYTVDLSDEIQIIGSEKTQNVTINPGPFAQTGYAPVNWGPGETNDSTTVEPVLDGPYQ
    PTTFSPPVSYWILLSPSNAGVVVEGTNNSDRWLATILIEPNVTSQSRTYTIFGRQEQITVENVSTTKWKF
    VDLAKTDINGTFTQHGQLLSDTKLYGVMKFSGRLYTYNGETPNATTGYYTTTNYDTVNMVSHCDFYIIPR
    SEESTCTNYINNGLPPIQNTKNVVPVSLTSR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Wen et al., 2015)
III. Vaccine Information
1. Porcine Rotavirus Modified Live Virus Vaccine (USDA: 19E1.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001805
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
2. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine (USDA: 19H1.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002193
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
IV. References
1. Hu and Wang, 2008: Hu J, Wang C. [Expression and immunogenicity analysis of recombinant plasmid pW425et-Vp7 of porcine rotavirus A in Lactobacillus]. Wei sheng wu xue bao = Acta microbiologica Sinica. 2008; 48(11); 1514-1519. [PubMed: 19149168].
2. Li et al., 2010: Li YJ, Ma GP, Li GW, Qiao XY, Ge JW, Tang LJ, Liu M, Liu LW. Oral vaccination with the porcine rotavirus VP4 outer capsid protein expressed by Lactococcus lactis induces specific antibody production. Journal of biomedicine & biotechnology. 2010; 2010; 708460. [PubMed: 20625406].
3. Wen et al., 2015: Wen X, Wei X, Ran X, Ni H, Cao S, Zhang Y. Immunogenicity of porcine P[6], P[7]-specific ?VP8* rotavirus subunit vaccines with a tetanus toxoid universal T cell epitope. Vaccine. 2015; 33(36); 4533-4539. [PubMed: 26192360].