VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Duck hepatitis virus 1

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. VP1 (Protective antigen)
  3. Vaccine Information
    1. Duck hepatitis virus 1 DNA vaccine pSCA/VP1
    2. Duck Virus Hepatitis Modified Live Virus Vaccine (USDA: 14B1.10)
  4. References
I. General Information
1. NCBI Taxonomy ID:
691956
2. Disease:
Duck virus hepatitis (DVH)
3. Introduction
Duck viral hepatitis is an acute, highly contagious, viral disease of young ducklings characterized by a short incubation period, sudden onset, high mortality, and characteristic liver lesions. The disease is of economic importance in all duck-raising areas of the world. Three distinct types of duck hepatitis virus (DHV) have been isolated from diseased ducklings.The originally described, most widespread, and most virulent DHV Type I is an enterovirus in the family Picornaviridae and is readily propagated in chick and duck embryos. It does not produce hemagglutinins. Field experience with DHV Type I indicates that egg transmission does not occur. The disease can be transmitted experimentally by parenteral or oral administration of infected tissues. Viruses differing from classic DHV Type I have been recognized as causes of hepatitis in ducklings. DHV Type II is considered to be an astrovirus and is difficult to propagate under laboratory conditions; DHV Type III is a member of the Picornaviridae, is antigenically distinct from Type I virus, and can be propagated in duck (but not chick) embryos. A distinct serologic variant of DHV Type I, named DHV Type Ia, has also been described (Merck Vet Manual: Duck Viral Hepatitis).
4. Host Ranges and Animal Models
A natural outbreak of DHV Type I has been reported in mallard ducklings; experimental DHV Type I infections have been produced in goslings, turkey poults, young pheasants, quail, and guinea fowl. The viruses that cause hepatitis in ducklings should not be confused with duck hepatitis B virus, a hepadnavirus infection of older ducks (Merck Vet Manual: Duck Viral Hepatitis).
1. VP1
  • Gene Name : VP1
  • Sequence Strain (Species/Organism) : Duck hepatitis A virus strain ZJ serotype 1
  • NCBI Protein GI : 129307224
  • Taxonomy ID : 1006061
  • Gene Strand (Orientation) : ?
  • Protein Name : VP1 protein
  • Protein Length : 238
  • Protein Note : vaccine strain; modified live virus
  • Protein Sequence : Show Sequence
    >gi|129307224|gb|ABO30521.1| VP1 protein [Duck hepatitis A virus 1]
    GDSNQLGDDEPVCFLNFETANVPIQGESHTLVKHLFGRQWLVRTVQHASTVQELDLQVPDRGHASLIRFF
    AYFSGEIILTIVNNGTTPAMVAHSYSMDDLSSEYAVTAMGGVMIPANSAKNIPVPFYSVTPLRPTRPIPG
    TSEATFGRLFMWTQSGSLSVFMGLKKPALFFPLPAPTSTTLSRGSNGVIPTLDQSGDEVDCHFCKICSKM
    KRMWKPKGHFRFCLRLKTLAFELDLEIE
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Duck hepatitis virus 1 DNA vaccine pSCA/VP1
III. Vaccine Information
1. Duck hepatitis virus 1 DNA vaccine pSCA/VP1
a. Vaccine Ontology ID:
VO_0004575
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Ducklings
e. Gene Engineering of VP1
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
pSCA1 (Fu et al., 2012)
g. Immunization Route
Intramuscular injection (i.m.)
h. Ducks Response
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: DHV-1-specific antibodies, neutralizing antibodies and lymphocyte proliferation were well induced in ducklings (Fu et al., 2012).
  • Efficacy: Vaccination with pSCA/VP1 could significantly reduce the onset and duration of viremia and decrease virus replication in ducklings (Fu et al., 2012).
2. Duck Virus Hepatitis Modified Live Virus Vaccine (USDA: 14B1.10)
a. Manufacturer:
International Duck Research Cooperative, Inc.
b. Vaccine Ontology ID:
VO_0001738
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Ducks
IV. References
1. Fu et al., 2012: Fu Y, Chen Z, Li C, Liu G. Protective immune responses in ducklings induced by a suicidal DNA vaccine of the VP1 gene of duck hepatitis virus type 1. Veterinary microbiology. 2012; 160(3-4); 314-318. [PubMed: 22819169].
2. Merck Vet Manual: Duck Viral Hepatitis: Merck Vet Manual: Duck Viral Hepatitis [http://www.merckvetmanual.com/mvm/index.jsp?cfile=htm/bc/202100.htm]