VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Equine arteritis virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. GL protein (Protective antigen)
    2. GP5 (Protective antigen)
    3. ORF6 (Protective antigen)
    4. ORF7 (Protective antigen)
  3. Vaccine Information
    1. Equine Arteritis Modified Live Virus Vaccine (USDA: 1531.20)
  4. References
I. General Information
1. NCBI Taxonomy ID:
11047
2. Disease:
Equine arteritis
3. Introduction
Equine viral arteritis (EVA) is a disease of horses caused by an RNA virus of the genus Arterivirus. The virus which causes EVA was first isolated from horses in Ohio in 1953 but the disease has afflicted equine animals worldwide for centuries. It has been more common in some breeds of horses in the United States, but there is no breed “immunity”. In the UK, it is a notifiable disease.There is no known human hazard. The virus which causes EVA is the Equine Arteritis Virus (EAV). Arteriviruses are small, enveloped, animal viruses with an icosahedral core containing a positive-sense RNA genome. The family includes Equine arteritis virus (EAV), porcine reproductive and respiratory syndrome virus (PRRSV), lactate dehydrogenase elevating virus (LDV) of mice and simian haemorrhagic fever virus (SHFV). Infected horses show variable symptoms including fever, depression, oedema, conjunctivitis, abortion and nasal discharge. Some horses show no symtoms of infection (Wiki: Equine viral arteritis).
4. Host Ranges and Animal Models
Equines (Wiki: Equine viral arteritis).
1. GL protein
  • Gene Name : GL protein
  • Sequence Strain (Species/Organism) : Equine arteritis virus
  • NCBI Protein GI : AAK37632
  • Other Database IDs : CDD:292603
    CDD:109986
  • Taxonomy ID : 11047
  • Protein Name : GL protein
  • Protein pI : 5.21
  • Protein Weight : 26616.85
  • Protein Length : 308
  • Protein Note : from horse with clinical symptoms
  • Protein Sequence : Show Sequence
    >AAK37632.1 GL protein [Equine arteritis virus]
    MLSMIVLLFLLWGVPSHAYFSYYTAQRFTDFTLCMLTDRGVIANLLRYDEHTALYNCSASKTCWYCEFLD
    EQIITFGTGCNETYSVPVSTVLEQAHGPYSVLFDDMPPFIYYGREFGIFVMDVFMFYPVLVLFFLSVLPY
    VTLVLEMCVSILFVVYGLYSGAYLAMGIFATTLVVHSVVVLRQLLWLCLAWRYRCTLHASFISAEGKIYP
    VDPGLPIAAAGNRLLVPGRPTIDYAVAYGNKVNLVRLGAAEVWEP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Balasuriya et al., 2002)
2. GP5
  • Gene Name : GP5
  • Sequence Strain (Species/Organism) : Equine arteritis virus
  • NCBI Protein GI : AFU74047
  • Other Database IDs : CDD:292603
    CDD:109986
  • Taxonomy ID : 11047
  • Protein Name : GP5
  • Protein pI : 5.02
  • Protein Weight : 18141.63
  • Protein Length : 227
  • Protein Note : Envelope glycoprotein GP 5 of equine arteritis virus; pfam15981
  • Protein Sequence : Show Sequence
    >AFU74047.1 GP5, partial [Equine arteritis virus]
    HTALYNCSASKTCWYCEFLSEQIITFGTGCNDTYSVPVSTVLEQAHGPYSVLFDDMPPFIYYGREFGIFV
    MDVFMFYPVLVLFFLSVLPYATLILEMCVSILFVVYGLYSGAYLAMGIFATTLVVHSVVVLRQLLWLCLA
    WRYRCTLHASFISAEGKIYPVDPGLPIAAAGNR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Balasuriya et al., 2004)
3. ORF6
  • Gene Name : ORF6
  • Sequence Strain (Species/Organism) : Equine arteritis virus
  • NCBI Protein GI : ATX64259
  • Other Database IDs : CDD:109986
  • Taxonomy ID : 11047
  • Protein Name : M
  • Protein pI : 9.92
  • Protein Weight : 16390.802
  • Protein Length : 205
  • Protein Note : Arterivirus GL envelope glycoprotein; pfam00951
  • Protein Sequence : Show Sequence
    >ATX64259.1 M [Equine arteritis virus]
    MGAIDSFCGDGILGEYLDYFILSVPLLLLLTRYVASGLVYVLTALFYSFVLAAYIWFVIVGRAFSTAYAF
    VLLAAFLLLVMRMIVGMMPRLRSIFNHRQLVVADFVDTPSGPVPIPRSTTQIVVRGNGYTAVGNKLVDGV
    KTITSAGRLFSKRAAATAYKLQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Balasuriya et al., 2002)
4. ORF7
  • Gene Name : ORF7
  • Sequence Strain (Species/Organism) : Equine arteritis virus
  • NCBI Protein GI : ATX64260
  • Other Database IDs : CDD:307571
  • Taxonomy ID : 11047
  • Protein Name : N
  • Protein pI : 12.13
  • Protein Weight : 12333.832
  • Protein Length : 152
  • Protein Note : Arterivirus nucleocapsid protein; pfam01481
  • Protein Sequence : Show Sequence
    >ATX64260.1 N [Equine arteritis virus]
    MASRRSRPQAASFRNGRRRQPTSYNDLLRMFGQMRVRKPPAQPTQAIIAEPGDLRHDLNQQERATLSSNV
    QRFFMIGHGSLTADAGGLTYTVSWVPTKQIQRKVAPPAGP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Hedges et al., 1998)
III. Vaccine Information
1. Equine Arteritis Modified Live Virus Vaccine (USDA: 1531.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001768
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Horse
IV. References
1. Balasuriya et al., 2002: Balasuriya UB, Heidner HW, Davis NL, Wagner HM, Hullinger PJ, Hedges JF, Williams JC, Johnston RE, David Wilson W, Liu IK, James MacLachlan N. Alphavirus replicon particles expressing the two major envelope proteins of equine arteritis virus induce high level protection against challenge with virulent virus in vaccinated horses. Vaccine. 2002; 20(11-12); 1609-1617. [PubMed: 11858869].
2. Balasuriya et al., 2004: Balasuriya UB, Dobbe JC, Heidner HW, Smalley VL, Navarrette A, Snijder EJ, MacLachlan NJ. Characterization of the neutralization determinants of equine arteritis virus using recombinant chimeric viruses and site-specific mutagenesis of an infectious cDNA clone. Virology. 2004; 321(2); 235-246. [PubMed: 15051384].
3. Hedges et al., 1998: Hedges JF, Balasuriya UB, Ahmad S, Timoney PJ, McCollum WH, Yilma T, MacLachlan NJ. Detection of antibodies to equine arteritis virus by enzyme linked immunosorbant assays utilizing G(L), M and N proteins expressed from recombinant baculoviruses. Journal of virological methods. 1998; 76(1-2); 127-137. [PubMed: 9923747].