VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Bovine papillomavirus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. L1 (Protective antigen)
    2. L2 (Protective antigen)
  3. Vaccine Information
    1. Wart Killed Virus Vaccine (USDA: 1985.50)
  4. References
I. General Information
1. NCBI Taxonomy ID:
10571
2. Disease:
Warts
3. Introduction
Bovine papillomavirus (BPV) is a group of DNA viruses of the family Papillomaviridae that are common in cattle. Infection causes warts (papillomas and fibropapillomas) of the skin and alimentary tract, and more rarely cancers of the alimentary tract and urinary bladder. They are also thought to cause the skin tumour equine sarcoid in horses and donkeys. BPV provides an excellent model for studying papillomavirus molecular biology, and also allows the dissection of the processes by which this group of viruses cause cancer. Like other papillomaviruses, BPVs are small non-enveloped viruses with an icosahedral capsid around 50–60 nm in diameter.The capsid is formed of the L1 and L2 structural proteins, with the L1 C-terminus exposed. All BPVs have a circular double-stranded DNA genome of 7.3–8.0 kb. The genetic organisation of those BPVs which have been sequenced is broadly similar to other papillomaviruses. The open reading frames (ORFs) are all located on one strand, and are divided into early and late regions. The early region encodes nonstructural proteins E1 to E7. There are three viral oncoproteins, E5, E6 and E7; BPVs of the Xipapillomavirus group lack E6. The late region encodes structural proteins L1 and L2. There is also a non-coding long control region (LCR) (Wiki: Bovine papillomavirus).
4. Host Ranges and Animal Models
Cattle are the main species affected. BPV-1 and BPV-2 can also induce sarcomas and fibrosarcomas in other mammals, including equids (equine sarcoid) and, experimentally, rabbits, hamsters and mice (Wiki: Bovine papillomavirus).
1. L1
  • Gene Name : L1
  • Sequence Strain (Species/Organism) : Bovine papillomavirus
  • NCBI Protein GI : AHB82182
  • Other Database IDs : CDD:305106
  • Taxonomy ID : 10571
  • Protein Name : L1 protein
  • Protein pI : 4.79
  • Protein Weight : 17306.81
  • Protein Length : 214
  • Protein Note : Bovine papillomavirus type 3;
    PCR_primers=fwd_name: my09, rev_name: my11
  • Protein Sequence : Show Sequence
    >AHB82182.1 L1 protein, partial [Bovine papillomavirus]
    AQGHNNGICWNNQLFVTAVDSTRGTNFTISVHRNKPSLEDQDTYTAADFKHYLRHVEEWEVSLVLQLCIV
    DLTPEALAHINGMDPRIIESWNLGFIHAPNNIEDQYRYLQSIATRCPPKEDAAATEDPYAKYTFWDVDLT
    ERFSMNLDQYPFGR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation :
2. L2
  • Gene Name : L2
  • Sequence Strain (Species/Organism) : Bovine papillomavirus
  • NCBI Protein GI : BAF95819
  • Other Database IDs : CDD:165142
    CDD:278914
  • Taxonomy ID : 453461
  • Protein Name : L2 protein
  • Protein pI : 4.61
  • Protein Weight : 54020.01
  • Protein Length : 591
  • Protein Note : type 10
  • Protein Sequence : Show Sequence
    >BAF95819.1 L2 protein [Bovine papillomavirus type 10]
    MVRAARRKRASEDDLYRGCLAGQDCPTDIKNKYEQNTLADRILKWVSSFLYFGTLGISSGRGSGGAGGYT
    RLGTVESGGGVRPGKGPNVARPTVIVDALGPAGAPIDPAAPDSAIVPLLESSGGSTTTDLIPGGGEIEII
    AEVHPPPTIGDPDIVIGEPDEPPILEVTPETHPASRVRYSTSKHDNPAFNAYVASSQLPGETSAADNVYI
    MHGFNGDYVGPATTDTVFEEIELQDIGVPESPPSASTPDSAFRTVLNRFQRRLYNRRLVQQVKLTDRTFL
    THPSRLVRWEFENPAFDESLSLLFEQDVNEVAAAPAEEFQDIVKLRRPFFSEKEGLVRVSRLGQRGTIRT
    RSGLQIGGHVHYFTDISPIRPVEDIEMQTFGEVSGDSIIMQPLGESTFINADDTIDANLNEGLLQYSDSV
    LEDDYNEDFSHVRLEVTTGTSTSIITVPDGIPPGSVKMFINDANSTVTPVPPDANGNAFTPITPRFPLTP
    LSPAYTPTVIIDFEDGSATFFLHPSLLRKHKHKHWFF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Jagu et al., 2011)
III. Vaccine Information
1. Wart Killed Virus Vaccine (USDA: 1985.50)
a. Manufacturer:
Colorado Serum Company, Biomune Company
b. Vaccine Ontology ID:
VO_0001584
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
IV. References
1. Jagu et al., 2011: Jagu S, Malandro N, Kwak K, Yuan H, Schlegel R, Palmer KE, Huh WK, Campo MS, Roden RB. A multimeric L2 vaccine for prevention of animal papillomavirus infections. Virology. 2011; 420(1); 43-50. [PubMed: 21920572].
2. Módolo et al., 2017: Módolo DG, Araldi RP, Mazzuchelli-de-Souza J, Pereira A, Pimenta DC, Zanphorlin LM, Beçak W, Menossi M, de Cassia Stocco R, de Carvalho RF. Integrated analysis of recombinant BPV-1 L1 protein for the production of a bovine papillomavirus VLP vaccine. Vaccine. 2017; 35(12); 1590-1593. [PubMed: 28222997].