VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Leptospira spp.

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. ligB (Protective antigen)
    2. ompL1 (Protective antigen)
  3. Vaccine Information
    1. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4019.00)
    2. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4059.00)
    3. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4069.20)
    4. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4089.00)
    5. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4089.20)
    6. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4129.00)
    7. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4179.00)
    8. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4209.00)
    9. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.20)
    10. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.21)
    11. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4335.20)
    12. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4336.30)
    13. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4141.20)
    14. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4339.00)
    15. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4359.00)
    16. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4399.20)
    17. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.00)
    18. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.20)
    19. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.21)
    20. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4435.20)
    21. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.24)
    22. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.25)
    23. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Haemophilus Somnus-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4489.30)
    24. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.00)
    25. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.20)
    26. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4479.00)
    27. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4509.00)
    28. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.20)
    29. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.22)
    30. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B5.20)
    31. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.20)
    32. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.21)
    33. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.20)
    34. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.22)
    35. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.20)
    36. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.21)
    37. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.22)
    38. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.20)
    39. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.21)
    40. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona-Mannheimia Haemolytica Bacterin (USDA: 4475.20)
    41. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.21)
    42. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.22)
    43. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.20)
    44. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.22)
    45. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.25)
    46. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.30)
    47. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.20)
    48. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.22)
    49. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.23)
    50. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.25)
    51. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.20)
    52. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.21)
    53. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.23)
    54. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.24)
    55. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.20)
    56. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.21)
    57. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.22)
    58. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.25)
    59. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.00)
    60. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.01)
    61. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.23)
    62. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.24)
    63. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.26)
    64. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Hardjo Bacterin (USDA: 4L49.20)
    65. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.20)
    66. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.26)
    67. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.30)
    68. Bovine Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 45B5.21)
    69. Bovine Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4595.21)
    70. Bovine Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4595.25)
    71. Bovine Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4599.00)
    72. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 47E5.21)
    73. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 47E5.20)
    74. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46E5.21)
    75. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46E5.24)
    76. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46E5.23)
    77. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46E5.25)
    78. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46E5.20)
    79. Canine Coronavirus Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46D5.27)
    80. Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4629.27)
    81. Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4629.20)
    82. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46B9.21)
    83. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.25)
    84. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.29)
    85. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47L9.20)
    86. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.21)
    87. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.26)
    88. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.27)
    89. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.20)
    90. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.22)
    91. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.20)
    92. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46L9.27)
    93. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.R1)
    94. Canine Distemper-Adenovirus Type 2-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46P9.27)
    95. Canine Distemper-Adenovirus Type 2-Parainfluenza Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4659.20)
    96. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 4637.29)
    97. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 4639.25)
    98. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47K1.20)
    99. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4639.27)
    100. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4639.28)
    101. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.20)_
    102. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.22)
    103. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.23)
    104. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.21)
    105. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.22)
    106. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J8.20)
    107. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.R1)
    108. Canine Distemper-Hepatitis-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 47P9.22)
    109. Canine Parainfluenza Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 47A9.20)
    110. Canine Parvovirus Modified Live Virus Vaccine-Leptospira Canicola Icterohaemorrhagiae Bacterin (USDA: 47B1.20)
    111. Leptospira interrogans DNA vaccine ompL1-pcDNA3.1(+)
    112. Leptospira interrogans DNA vaccine pTARGET/ LigBrep
    113. Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4989.00)
    114. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.20)
    115. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.21)
    116. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.22)
    117. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.01)
    118. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.20)
    119. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.21)
    120. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.22)
    121. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.01)
    122. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.20)
    123. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.22)
    124. Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4960.00)
    125. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.22)
    126. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.23)
    127. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.24)
    128. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.22)
    129. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.23)
    130. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.24)
    131. Porcine Reproductive & Respiratory Syndrome-Parvovirus Reproductive Form, Modified Live & Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4P19.20)
    132. Trichomonas Foetus Vaccine, Killed Protozoa-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4990.00)
  4. References
I. General Information
1. NCBI Taxonomy ID:
171
2. Disease:
Leptospirosis
3. Introduction
Leptospirosis (also known as Weil's disease, Weil's syndrome, canicola fever, canefield fever, nanukayami fever, 7-day fever, Rat Catcher's Yellows, Fort Bragg fever, and Pretibial fever) is a bacterial zoonotic disease caused by spirochaetes of the genus Leptospira that affects humans and a wide range of animals, including mammals, birds, amphibians, and reptiles. The disease was first described by Adolf Weil in 1886 when he reported an "acute infectious disease with enlargement of spleen, jaundice and nephritis". Leptospira was first observed in 1907 from a post mortem renal tissue slice. In 1908, Inada and Ito first identified it as the causative organism and in 1916 noted its presence in rats. Though recognised among the world's most common zoonoses, leptospirosis is a relatively rare bacterial infection in humans. The infection is commonly transmitted to humans by allowing water that has been contaminated by animal urine to come in contact with unhealed breaks in the skin, the eyes, or with the mucous membranes. Outside of tropical areas, leptospirosis cases have a relatively distinct seasonality with most of them occurring August–September/February–March.

Leptospirosis is caused by a spirochaete bacterium called Leptospira spp. that has at least 5 serovars of importance in the United States and Canada causing disease in dogs (Icterohaemorrhagiae, Canicola, Pomona, Grippotyphosa, and Bratislava).There are other (less common) infectious strains. Genetically different leptospira organisms may be identical serologically and vice versa. Hence, an argument exists on the basis of strain identification. The traditional serologic system is seemingly more useful from a diagnostic and epidemiologic standpoint at the moment (which may change with further development and spread of technologies like PCR).

Leptospirosis is transmitted by the urine of an infected animal and is contagious as long as it is still moist. Although rats, mice and moles are important primary hosts, a wide range of other mammals including dogs, deer, rabbits, hedgehogs, cows, sheep, raccoons, possums, skunks, and certain marine mammals are able to carry and transmit the disease as secondary hosts. Dogs may lick the urine of an infected animal off the grass or soil, or drink from an infected puddle. There have been reports of "house dogs" contracting leptospirosis apparently from licking the urine of infected mice that entered the house. The type of habitats most likely to carry infective bacteria are muddy riverbanks, ditches, gullies, and muddy livestock rearing areas where there is regular passage of either wild or farm mammals. There is a direct correlation between the amount of rainfall and the incidence of leptospirosis, making it seasonal in temperate climates and year-round in tropical climates.

Leptospirosis is also transmitted by the semen of infected animals. Slaughterhouse workers may contract the disease through contact with infected blood or body fluids.

Humans become infected through contact with water, food, or soil containing urine from these infected animals. This may happen by swallowing contaminated food or water, or through skin contact. The disease is not known to be spread from person to person and cases of bacterial dissemination in convalescence are extremely rare in humans. Leptospirosis is common among water-sport enthusiasts in specific areas as prolonged immersion in water is known to promote the entry of the bacteria. Surfers and whitewater paddlers are at especially high risk in areas that have been shown to contain the bacteria, and can contract the disease by swallowing contaminated water, splashing contaminated water into their eyes or nose, or exposing open wounds to infected water. Occupations at risk include veterinarians, slaughterhouse workers, farmers, sewer workers, and people working on derelict buildings. Rowers are also sometimes known to contract the disease (Wiki: Leptospirosis).
4. Host Ranges and Animal Models
Leptospirosis is transmitted by the urine of an infected animal and is contagious as long as it is still moist. Although rats, mice and moles are important primary hosts, a wide range of other mammals including dogs, deer, rabbits, hedgehogs, cows, sheep, raccoons, possums, skunks, and certain marine mammals are able to carry and transmit the disease as secondary hosts (Wiki: Leptospirosis).
1. ligB
  • Gene Name : ligB
  • Sequence Strain (Species/Organism) : Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
  • NCBI Gene ID : 2771118
  • NCBI Protein GI : 45656362
  • Locus Tag : LIC10464
  • Genbank Accession : AE016823
  • Protein Accession : YP_000448
  • Taxonomy ID : 267671
  • Chromosome No : I
  • Gene Starting Position : 526394
  • Gene Ending Position : 532066
  • Gene Strand (Orientation) : -
  • Protein Name : hypothetical protein
  • Protein pI : 7.03
  • Protein Weight : 190366.08
  • Protein Length : 1890
  • Protein Note : Big; identified by sequence similarity; ORF located using Blastx/Glimmer
  • DNA Sequence : Show Sequence
    >gi|45655914:526394-532066 Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 chromosome I, complete sequence
    ATTATTGATTCTGTTGTCTGTAAATTTTGACCGGTTTATTTTTGTTTCCTACGCTTATATATACGAAATT
    TACACCAAAATTCATTCCGGATATAGCCGAATAAATTTGACGATTGGTAACGTCTCTTAATCCGCCTATT
    CCTATAGGTTCCCAGTTGTGTGATGAACTTCCAGGATTTTCAAGATTTGTTCTCCAGATTTGAATTCCGT
    TTTCGTTATCAAAACCTATGTAGAGATAAGATCCACTTGCAACCATCATCGTCATACTGTGATTGGAATT
    GTCTCCAAAGTTTGTAAATCCGGTTCCGTTATCTCCTACTAAAGACCAATCTTCTGCTTCGCAGGTTGTT
    GTATCGCCGGTTAGAGTCGGATCACATTTCCAAAGTTGGGGTCTTCGATTTGTATAACTTCCGTCCGTAC
    AACCTTCCACAGTTTGTAAACTTTGTCTGAGTCCGGAGTGATCTTCTTTCGTTACGCAGATCGTTCTTGT
    TACATACAATCTTCCGTTAAATTCTGCGAATTGAGAGAATGCTTTATCCGCCGGAATTAAATTCCGATAC
    TTTGTAAGCTCCAGTGAAAACCAATTGTTATGAGGAGAGTTATGCCACTTCGGATTGGATCTAGGTGCTG
    TGTCTTTCCAACTGGAACAACGATTGCTCCCCTCACAAGGACTAGGATTTGCACTGGTAGAGTGTATTAT
    ACTTCCATTATGTAGTGAATTTGGAAATCCTCCGTTTGCGGCGTAAAGTTTTTCTTTAAAAACGAATAGA
    GAATCTATTCCCACATAATAACCCCAGTTGATCGAGGAGTTATCAGATGTATAAGTTTCATAATTGTCTG
    CATCCTCCACGGAGAGGCCGCCGAAATAAGGCATTCTATCGATTCTAAAACGATTACCGCGGTATCCGTC
    AGAGGCGTCACAATTGTTTCCGGCTGCACATCTATTTTGATCGGATGTATTAAAGGTGATTTTACCGAAA
    TCAGGTGCGTTTAGATTTTTATTTTTTTTTGCAAAACCCACATGGATCCGATCGTCTATAACCGCGATAG
    ATGAAGTTCCTGCAGTCGCCGTTCCAGTAATTTCTCCCATATCGATATATTTAAAATTAAGATTTGTATC
    GGTATCTGAGGAATAATAGAGATAGTCGAATCTCCTTGGTCTTGAACCTGCTATAAAAATATGAGATTTT
    TTGTTTAATGATCCGATGGCAAAAACTCCACGTCCATCTTCGTTATCCGGACCACATCCAGTAGTAATGT
    CTGCACTATTGAGAGTACAACCGGTATGACCGATCGTAACGTAATTCGGAACCGGAATTCCTCCATCTCT
    TGAAGACGCACGGTTATCGGCATTTATATCTTTGGTAAAAGAGAAAAAAATAGATTCGGGAAAAGTTCCG
    TCGTAATTGAATCGAGCTGCTTGGTTTCCTTTTACATTCGGTCCTAGATAGATTTGATTGTTGTAATCTA
    CAAGAAAGCCGAAATCGGAACCGTCTCCAAAAGGATCTGACATGATCGGGCCATCCATAAAGTTGAGAGG
    GGAATTTCCACAACCTATAAAGTTGATTCTATCTTTCGGAGAAGATTGTAGGTTTTCTTGATCGAATGAA
    TCTCTAATTGCTCCCCAGGATTTGTTGTCAAAGCCGTCTCCGTTCAAATCATTTGCGGCGATGATCGTAT
    ATTGACCACCTGATTGAAGAAGGGAGTGTGTTAAACATATTTTCGAGGAGTCTGCCGGTGCTCCACCGCA
    TACTTTTCCATCTAAAATTCTAACGCTCGTAATACTTCCCAATGAAGACACACCTGCAAATTTATATCTG
    GATTCACACTGGGACGGATTTGAACATTCCACGGATTTTGTTGCTTCCTTTCCCGAATATAAAGGTTTGG
    AAAAAGAAACGATCACTTGGTTTAAGGAATTACAAACTGCACTTGTAAGTTTGAGTTGTTCTTTTCCTAT
    AAAATCAGAGTTATTTGGACAACTTAAGGAATTTGGAATGGAAGAAAGATCGTGAATTCCTTGTTTGTTG
    ACTACAAGTGTGTATGATTTGTTTAAGATTTGTGAATGTGAAAGTGTGATCGTAAAAGTATTTTTACTTC
    CTTTGATACTACTAAGAGAAAAATCTGCGGTTTGAGAATTGGAATTGAAGTCCGTATTATCTGAACAATG
    TCCTATAAAATTGGAACTATCAATTATTTTGTAATTGGATAAATCAAGGGCTTCCTTATTGTTTATGGAT
    TCTGAATATACAACTTGGATGGTAGTAGGTGATAAGGAAACTACCGATTGAACCGTTGGAGCTATCGTGT
    CCGTTTTGTTTACTGTGAGGATTGTATTTCCAGATACTGAACCGTAGGTCGCTGTGATTATAGAGTTTCC
    AGAAGCAATCCCTGTAACCAATCCTTTCGTTTTAGATGCGTTACTCACCTTTGCCTGAGATTTATTTGAG
    CTGGACCATGTAACCGAAGAAGTTAAATCCGCTTTGGTCCCATCCGAATACGTTCCCACCGCGAAAAATT
    GTTTTGATACGGTTGCGTTTATATTTGTATTGATAGGAGATATTGAAATCGAAGAAAGGGTTGCTGCGCT
    GACCGTTATGTCTATGTTTTCCGAGATGGAATTGTAAGTCGCAGTGATTTTGCTGTTTCCAATCTGTAAA
    GCGGTCGCTTTTCCCTTGGTTTCGGTCGAATTAGAGATGCTGATCGAGTCAGAATTGGAACTGGACCAGG
    TAACTGAATCGCTGATGTCCTGAATGGTGGAGTCTGAATAAACGCCAAGCGCAGTATATTGTTGGGTAAG
    TCCCTTGGCGATGTTATTGTTGACTGGATTGATTTTAATGGAATCTAACGTGGCAGCACTTACATTAAAA
    TTTATTTTATTACTGCTTATAGAATTGTAAATCGCAGAGATGTTGGAAGAACCTATTGAAAGTGCGGTTG
    CTAAACCTTTTGCATTGGCAGCGTTATTGATAGGGGCAACGTCGGATTTGGAAGAATACCAGGTCACAAG
    ATTCGTAATTTCTTGTTCAGAGCCATCTATAAAAGTTCCGATCGCTTTAAATTGCTGGGTCAATCCTTTG
    GCTATTGAACTTGAGGAAGGACTGATAGTTATACTTTTCAGTTTTAAGTCAGTGACTGTAATCGGAATTG
    GGGAGCTTTGGATGAATTTGTAGACGGCCTTAATATTCGAACTTCCTAATTTAGAGGCTGTCGCTATACC
    TTTTTTACCGGAAGTGTTTTCGATCTCAATCTTAGATGGATCGGAAGAAATCCAAGTTACAAGCTGAGTC
    AAATTTTGAGTAGATTTATCTGAAAAGATACCAGTCGCTTTAAATTGTTTTGTAAGACCGTGAGTGATAG
    AGTTAATCGTCGGTGTTATCTCGATAGAAGTAAGAAGTGCAGGAGTGACATTCAAAACGGAAGAGCCAGA
    TATGGAGTCTATCGTTGCTTTAATATTTGTATTTCCGGTAGCCACTGTTGTAACCGAACCTGTAACGTTG
    TTAACCATTGCTTTTCCGGGATTGGAAGAAGACCAGGTAGCTAGGGCAGTCACGTCTTGTACGGAATGAT
    CCGTATATGTTCCGGTGGCTTTAAATTGTCGTATTAGACCTTTTGCAACTGACGGATTTATAGGTGTTAC
    GGCAATGGAAATCAATTGTGCCGGAGTTACCTTTAAAATTACTTTAGAACTTTTGATTGAACCGAGGGCT
    GCGGATATTTCACTCGATCCTGGAGTGAGTGTATTTGTAATACCTTTACTTCCACTGGTATTTTTAATTT
    CAGCAATATCCGTATTAGAGGAATTCCAGGTAACTTGATTTGTAATATCGGAATTTGAGTTATCCGTAAA
    GATACCAGTAGCCTTGAATCTTTCTGTGAGTCCCTTTGCTTTGGAAGCAGCAGCCGGTGTGATTTGGATT
    TCAACAAGCTTTGCAGCTGTAACAGATAACGTAGAAACCGGACTACTTACCTTTCCGAATGTGGCTTTAA
    TATCCGTTGCTCCTGTAGCTGCTCCGTAAGCGTTTCCTTGATTTTTTTGGGCGTTTGAAATCGTCGCGAT
    TGAAGAATCGGATGAGAACCACGTAACAGCGGAAGTAATGTCCTTGTTAGAGTTGTCAGAGTAGATCCCA
    GTAGCCGTAAATTTTTGAGTTAACCCTTTTGCAAGAGAAGGATTTACAGGATTGATTTGAATAGAAGTGA
    GAACCGCAGGAACTACAGTAAACCAAGTGTTACCTGAAACTTTTCCTAAGGTTGCGGTAATAGTCGTGTT
    TCCAACTGAGTTGGTTTTTCCCAGACCTTTATTGTTGTCTAAGTTAGACACGCTTACGATTGCTGAAGAA
    GAATTCCAAGTGACTTGATCCGTAATATCCTTCTTAGAGTTATCCGTAAAAATCCCGATCGCAGTAAACT
    TTTGAGTTAGTCCTTTTGCAATGGAAGTGCGAGTTGGAGAGACTTCGATGGAAGTCAATGCAGCTTGTGT
    AACTTTAAAATCAGTGGATCCTTGTATTCCACCGATGGAAGCAGTGACTTTAACATTCCCTTGGTTGAGT
    GTGGAAGCTAATCCGTGGCTATCACTTGCATTGGAAATTGAGAGAATATCGGTATTAGAAGAATCCCAAG
    TAACTTGGTCGGTAATATCCGAGTTTGAATTATCTGTAAAGATCCCTGTAGCTTTAAAGTTTTCTTGTAA
    ACCTTTTGCAACTGTAGAATTTGTCGGAGAAACAGAAATAGAAACTAAGGCTGCTGGAGTAACGATTAGT
    TTTACGGATCCGATTATATTCTCGCTAGAAGCAGAAACAGTGACAATACCAGTATCAGCTGTTTCTAATA
    TTCCGTTGTTTTGAATATTAGCGATAGTGGAATTAGAAGAATTCCAAATAACAGAAGAGGAAATATCCCT
    GTTAGAGTTATCCGAATAGATTCCCGTAGCTGTTAGTTTTTGTTTTTTTCCGAGAGGAATATTCAGATCG
    TTTGAAGTTACTTGGATTTGAGAGAGAACAGCATCTCCAACGGTCATTTCTTCAGCCCCTTGTTTTGATT
    GAAAGGATGCACGAATATGAGCTGTTCCTAAATTGATCCCTGATGCCAACCCTGAATCATCTACTCGAAC
    CAAATCAGGATTACTGGAAGACCAAACGATCAGTGGTTCGTTGGAAATATCCTGATGAGAACCATCCGAA
    AAGATACCGATGGCTGAGAATTGACGATTAGTACCTTTAGGTAGTATACCTGACTCTAAACTCGTAACTT
    GAATTGAGTTAAGAATGGCTGGTGTAACGGTAATTTTTTGTTCAGAGTATAGGCCGTTGTATTCTGCTTT
    TATAATGGAAGAACCAGAAGCGATTCCTTTGACTCTGTTGCCTTCGATTGTTACAACGGATTGGGAATCG
    GGGACGATGGATGTCAAATCCGTAATATTCTGATTTGTTCCGTTATCAAAGATTGCGGTAACTTCTAGGG
    TTGTACTGGTACCGTTTGCGATAGAAGAATCTTGATAACTAAGTTCGATTCTTGTAATAGTCGGATTGAA
    GTTACCTAACAGAAGGTGGAAAAAGGACAGCCCATTACTTTTTTTACCAGCGGTTAATCCTACCAGACCG
    GTTAAAAGTGGCCAAGACATACAACTTTGAAAAAACATCGAAAGAAAAATCGAAATACAAAATATTTTCT
    TCA
  • Protein Sequence : Show Sequence
    >gi|45656362|ref|YP_000448.1| hypothetical protein LIC10464 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130]
    MKKIFCISIFLSMFFQSCMSWPLLTGLVGLTAGKKSNGLSFFHLLLGNFNPTITRIELSYQDSSIANGTS
    TTLEVTAIFDNGTNQNITDLTSIVPDSQSVVTIEGNRVKGIASGSSIIKAEYNGLYSEQKITVTPAILNS
    IQVTSLESGILPKGTNRQFSAIGIFSDGSHQDISNEPLIVWSSSNPDLVRVDDSGLASGINLGTAHIRAS
    FQSKQGAEEMTVGDAVLSQIQVTSNDLNIPLGKKQKLTATGIYSDNSNRDISSSVIWNSSNSTIANIQNN
    GILETADTGIVTVSASSENIIGSVKLIVTPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQ
    VTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFKVTQAALTSIEVSPTRTSIAKGLT
    QKFTAIGIFTDNSKKDITDQVTWNSSSAIVSVSNLDNNKGLGKTNSVGNTTITATLGKVSGNTWFTVVPA
    VLTSIQINPVNPSLAKGLTQKFTATGIYSDNSNKDITSAVTWFSSDSSIATISNAQKNQGNAYGAATGAT
    DIKATFGKVSSPVSTLSVTAAKLVEIQITPAAASKAKGLTERFKATGIFTDNSNSDITNQVTWNSSNTDI
    AEIKNTSGSKGITNTLTPGSSEISAALGSIKSSKVILKVTPAQLISIAVTPINPSVAKGLIRQFKATGTY
    TDHSVQDVTALATWSSSNPGKAMVNNVTGSVTTVATGNTNIKATIDSISGSSVLNVTPALLTSIEITPTI
    NSITHGLTKQFKATGIFSDKSTQNLTQLVTWISSDPSKIEIENTSGKKGIATASKLGSSNIKAVYKFIQS
    SPIPITVTDLKLKSITISPSSSSIAKGLTQQFKAIGTFIDGSEQEITNLVTWYSSKSDVAPINNAANAKG
    LATALSIGSSNISAIYNSISSNKINFNVSAATLDSIKINPVNNNIAKGLTQQYTALGVYSDSTIQDISDS
    VTWSSSNSDSISISNSTETKGKATALQIGNSKITATYNSISENIDITVSAATLSSISISPINTNINATVS
    KQFFAVGTYSDGTKADLTSSVTWSSSNKSQAKVSNASKTKGLVTGIASGNSIITATYGSVSGNTILTVNK
    TDTIAPTVQSVVSLSPTTIQVVYSESINNKEALDLSNYKIIDSSNFIGHCSDNTDFNSNSQTADFSLSSI
    KGSKNTFTITLSHSQILNKSYTLVVNKQGIHDLSSIPNSLSCPNNSDFIGKEQLKLTSAVCNSLNQVIVS
    FSKPLYSGKEATKSVECSNPSQCESRYKFAGVSSLGSITSVRILDGKVCGGAPADSSKICLTHSLLQSGG
    QYTIIAANDLNGDGFDNKSWGAIRDSFDQENLQSSPKDRINFIGCGNSPLNFMDGPIMSDPFGDGSDFGF
    LVDYNNQIYLGPNVKGNQAARFNYDGTFPESIFFSFTKDINADNRASSRDGGIPVPNYVTIGHTGCTLNS
    ADITTGCGPDNEDGRGVFAIGSLNKKSHIFIAGSRPRRFDYLYYSSDTDTNLNFKYIDMGEITGTATAGT
    SSIAVIDDRIHVGFAKKNKNLNAPDFGKITFNTSDQNRCAAGNNCDASDGYRGNRFRIDRMPYFGGLSVE
    DADNYETYTSDNSSINWGYYVGIDSLFVFKEKLYAANGGFPNSLHNGSIIHSTSANPSPCEGSNRCSSWK
    DTAPRSNPKWHNSPHNNWFSLELTKYRNLIPADKAFSQFAEFNGRLYVTRTICVTKEDHSGLRQSLQTVE
    GCTDGSYTNRRPQLWKCDPTLTGDTTTCEAEDWSLVGDNGTGFTNFGDNSNHSMTMMVASGSYLYIGFDN
    ENGIQIWRTNLENPGSSSHNWEPIGIGGLRDVTNRQIYSAISGMNFGVNFVYISVGNKNKPVKIYRQQNQ
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Leptospira interrogans DNA vaccine pTARGET/ LigBrep
2. ompL1
  • Gene Name : ompL1
  • Sequence Strain (Species/Organism) : Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
  • NCBI Gene ID : 2769678
  • NCBI Protein GI : 45656861
  • Locus Tag : LIC10973
  • Genbank Accession : AE016823
  • Protein Accession : YP_000947
  • Taxonomy ID : 267671
  • Chromosome No : I
  • Gene Starting Position : 1173341
  • Gene Ending Position : 1174303
  • Gene Strand (Orientation) : -
  • Protein Name : outer membrane protein
  • Protein pI : 8.87
  • Protein Weight : 31373.06
  • Protein Length : 320
  • Protein Note : contains porin activity; identified by sequence similarity; ORF located using Blastx/Glimmer
  • DNA Sequence : Show Sequence
    >gi|45655914:1173341-1174303 Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 chromosome I, complete sequence
    CTTAGAGTTCGTGTTTATAACCGAATCTGTAGATTTGCCCACCGACAACGATTGGATATGCAGGAAAAGG
    AGAAAGGTTCGTAGCTCCTCCTGCAGATTGAGTTTTACCAACTGCATACGCAGCAGACATGATCGTTTCT
    AATTCAAGAAAAACGTGTCCTTTATCGGTTACTCTGGCCTGAGTTCCAATTAAAAAGTTAGGAGCAATTC
    CAGAAGTTCTAAATCGAACGTGTTCACGAGTCGTGACTGGATCTGTTCCGTCTGCGATCAAGTTTGCAAC
    ACTTCCCGCTCCCGCTGCAGCTAAAATGTCATGACCTCCTTTGAGGTTGTTTGATCCGTTTAAACTCCAT
    CCACCATTGAAATAGTTTAAACCTGCTCCCATATATATTGCAGCGTCTTCAGTAACATTCAATTTGATAC
    CAACGGTTGCAGGAATGACGATAGAACTAAAACCCCAAGTCATATCTACAATGTTATAACCAGCGATGTC
    TGCTTTTGTAATACCGCCAGAAATTTTTTGAGTATATTCTGCAGCAACTCTCCAGAAAAAATATTTACCA
    AAGTCGGACTCATAACCTACCATCAAGTTTCCTCCGACCATGGCGCCTTTAGTGCTTCTTGCGTTGATCA
    AGCCGCCAGTAGTTCTATCGAGGGTAATCAATTTATTTTCAGCAGGAATCGCTTTTCTGGGAGCAACTCC
    TAGATAATTTCCTTCACCTGTAGGTTTTCCTGGATTTTGTACACAAGTAGGATCGTTTGGACCTACTGTA
    CAAGTATCTGTTGATCGGACCGGGCCATAATAACTTGCAGCGTCTAAACCATCTTTGGTGATGGTTCCTC
    CTAATTGTCCTAGGTCTAACTGTAACCCAAATCCTACAATTGCATATGTTTTTGCACTTAGGCTTGCAGC
    CGAAGATAATGCTACGGCTAAAATGAGCAATGCCTTACTTATGTTACGGATCA
  • Protein Sequence : Show Sequence
    >gi|45656861|ref|YP_000947.1| outer membrane protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130]
    MIRNISKALLILAVALSSAASLSAKTYAIVGFGLQLDLGQLGGTITKDGLDAASYYGPVRSTDTCTVGPN
    DPTCVQNPGKPTGEGNYLGVAPRKAIPAENKLITLDRTTGGLINARSTKGAMVGGNLMVGYESDFGKYFF
    WRVAAEYTQKISGGITKADIAGYNIVDMTWGFSSIVIPATVGIKLNVTEDAAIYMGAGLNYFNGGWSLNG
    SNNLKGGHDILAAAGAGSVANLIADGTDPVTTREHVRFRTSGIAPNFLIGTQARVTDKGHVFLELETIMS
    AAYAVGKTQSAGGATNLSPFPAYPIVVGGQIYRFGYKHEL
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Leptospira interrogans DNA vaccine ompL1-pcDNA3.1(+)
III. Vaccine Information
1. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4019.00)
a. Manufacturer:
Wyeth, Colorado Serum Company
b. Vaccine Ontology ID:
VO_0001880
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
2. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4059.00)
a. Manufacturer:
Colorado Serum Company
b. Vaccine Ontology ID:
VO_0001881
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
3. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4069.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001882
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
4. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4089.00)
a. Manufacturer:
Colorado Serum Company, Heska Corporation
b. Vaccine Ontology ID:
VO_0001883
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
5. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4089.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc., Heska Corporation, Merial, Inc.
b. Vaccine Ontology ID:
VO_0001884
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
6. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4129.00)
a. Manufacturer:
Colorado Serum Company, Heska Corporation
b. Vaccine Ontology ID:
VO_0001892
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
7. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4179.00)
a. Manufacturer:
Colorado Serum Company
b. Vaccine Ontology ID:
VO_0001893
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
8. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4209.00)
a. Manufacturer:
Colorado Serum Company, Heska Corporation
b. Vaccine Ontology ID:
VO_0001894
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
9. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.20)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0001903
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
10. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.21)
a. Manufacturer:
Heska Corporation
b. Vaccine Ontology ID:
VO_0001904
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
11. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4335.20)
a. Manufacturer:
Heska Corporation
b. Vaccine Ontology ID:
VO_0001907
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
12. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4336.30)
a. Manufacturer:
Heska Corporation
b. Vaccine Ontology ID:
VO_0001908
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
13. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4141.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc.
b. Vaccine Ontology ID:
VO_0001914
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
14. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4339.00)
a. Manufacturer:
Colorado Serum Company, Heska Corporation
b. Vaccine Ontology ID:
VO_0001915
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
15. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4359.00)
a. Manufacturer:
Colorado Serum Company
b. Vaccine Ontology ID:
VO_0001916
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
16. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4399.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001917
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
17. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.00)
a. Manufacturer:
Colorado Serum Company, Heska Corporation
b. Vaccine Ontology ID:
VO_0001918
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
18. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc., Merial, Inc.
b. Vaccine Ontology ID:
VO_0001919
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
19. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.21)
a. Manufacturer:
Heska Corporation
b. Vaccine Ontology ID:
VO_0001920
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
20. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4435.20)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0001922
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
21. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.24)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001931
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
22. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.25)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001932
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
23. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Haemophilus Somnus-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4489.30)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0001933
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
24. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.00)
a. Manufacturer:
Colorado Serum Company
b. Vaccine Ontology ID:
VO_0001934
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
25. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.20)
a. Manufacturer:
Wyeth, Heska Corporation, Merial, Inc.
b. Vaccine Ontology ID:
VO_0001935
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
26. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4479.00)
a. Manufacturer:
Colorado Serum Company
b. Vaccine Ontology ID:
VO_0001936
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
27. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4509.00)
a. Manufacturer:
Colorado Serum Company, Heska Corporation
b. Vaccine Ontology ID:
VO_0001937
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
28. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.20)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0001951
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
29. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.22)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0001952
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
30. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B5.20)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0001953
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
31. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.20)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0001954
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
32. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.21)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0001955
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
33. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.20)
a. Manufacturer:
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0001959
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
34. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.22)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0001960
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
35. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.20)
a. Manufacturer:
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Merial, Inc., Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0001962
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
36. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001963
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
37. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.22)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001964
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
38. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.20)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0001965
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
39. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.21)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0001966
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
40. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona-Mannheimia Haemolytica Bacterin (USDA: 4475.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001967
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
41. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.21)
a. Manufacturer:
Heska Corporation
b. Vaccine Ontology ID:
VO_0001975
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
42. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001976
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
43. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.20)
a. Manufacturer:
Heska Corporation
b. Vaccine Ontology ID:
VO_0001978
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
44. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001979
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
45. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.25)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001980
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
46. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.30)
a. Manufacturer:
Heska Corporation
b. Vaccine Ontology ID:
VO_0001981
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
47. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc.
b. Vaccine Ontology ID:
VO_0001982
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
48. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001983
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
49. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.23)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001984
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
50. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.25)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001985
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
51. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0001990
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
52. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.21)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0001991
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
53. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.23)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0001992
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
54. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.24)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0001993
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
55. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.20)
a. Manufacturer:
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Heska Corporation
b. Vaccine Ontology ID:
VO_0001994
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
56. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.21)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001995
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
57. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.22)
a. Manufacturer:
Wyeth, Intervet Inc.
b. Vaccine Ontology ID:
VO_0001996
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
58. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.25)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001997
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
59. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.00)
a. Manufacturer:
Heska Corporation
b. Vaccine Ontology ID:
VO_0001998
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
60. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.01)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0001999
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
61. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.23)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002000
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
62. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.24)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002001
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
63. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.26)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002002
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
64. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Hardjo Bacterin (USDA: 4L49.20)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002003
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
65. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.20)
a. Manufacturer:
Heska Corporation
b. Vaccine Ontology ID:
VO_0002013
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
66. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.26)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002014
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
67. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.30)
a. Manufacturer:
Heska Corporation
b. Vaccine Ontology ID:
VO_0002015
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
68. Bovine Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 45B5.21)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002023
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
69. Bovine Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4595.21)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002025
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
70. Bovine Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4595.25)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002026
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
71. Bovine Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4599.00)
a. Manufacturer:
Colorado Serum Company
b. Vaccine Ontology ID:
VO_0002027
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
72. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 47E5.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002244
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
73. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 47E5.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002243
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
74. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46E5.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002222
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
75. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46E5.24)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002224
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
76. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46E5.23)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002223
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
77. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46E5.25)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002225
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
78. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46E5.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002221
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
79. Canine Coronavirus Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46D5.27)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002220
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
80. Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4629.27)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002207
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
81. Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4629.20)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002206
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
82. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46B9.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002219
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
83. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.25)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002231
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
84. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.29)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002234
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
85. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47L9.20)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002246
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
86. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002230
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
87. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.26)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002232
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
88. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.27)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002233
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
89. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.20)
a. Manufacturer:
Intervet Inc., Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002226
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
90. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002227
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
91. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002229
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
92. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46L9.27)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002236
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
93. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.R1)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0002235
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
94. Canine Distemper-Adenovirus Type 2-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46P9.27)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002237
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
95. Canine Distemper-Adenovirus Type 2-Parainfluenza Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4659.20)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002218
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
96. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 4637.29)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002211
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
97. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 4639.25)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002214
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
98. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47K1.20)
a. Manufacturer:
Intervet Inc., Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002245
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
99. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4639.27)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002215
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
100. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4639.28)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002216
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
101. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.20)_
a. Manufacturer:
Intervet Inc., Pfizer, Inc.
b. Type:
Live, attenuated vaccine
c. Status:
Licensed
d. Location Licensed:
USA
e. Host Species for Licensed Use:
Gray wolf
102. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.22)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002209
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
103. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.23)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002210
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
104. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.21)
a. Manufacturer:
Wyeth, Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002212
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
105. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002213
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
106. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J8.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002228
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
107. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.R1)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0002217
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
108. Canine Distemper-Hepatitis-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 47P9.22)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002247
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
109. Canine Parainfluenza Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 47A9.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0004213
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
110. Canine Parvovirus Modified Live Virus Vaccine-Leptospira Canicola Icterohaemorrhagiae Bacterin (USDA: 47B1.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002240
c. Status:
Licensed
d. Location Licensed:
USA
e. Host Species for Licensed Use:
Gray wolf
111. Leptospira interrogans DNA vaccine ompL1-pcDNA3.1(+)
a. Vaccine Ontology ID:
VO_0004562
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Hamsters
e. Gene Engineering of ompL1
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3.1(+) (Maneewatch et al., 2007)
g. Immunization Route
Intramuscular injection (i.m.)
h. Hamster Response
  • Vaccine Immune Response Type: VO_0003057
  • Efficacy: The vaccine was shown to confer the delay in the death time and reduced morbidity in the vaccinated animals when compared to animals immunized with the plasmid alone or PBS. Hamsters of group 2 (mock) and group 3 (positive leptospirosis) were all dead between days 5 and 6 post-challenge. For the vaccinated group, two hamsters were dead on day 9, one each died on days 11 and 18, respectively. Two hamsters survived the lethal Leptospira challenge until day 21 when they were sacrificed (Maneewatch et al., 2007).
112. Leptospira interrogans DNA vaccine pTARGET/ LigBrep
a. Vaccine Ontology ID:
VO_0004563
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Hamsters
e. Gene Engineering of ligB
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
pTARGET (Forster et al., 2013)
g. Immunization Route
Intramuscular injection (i.m.)
h. Hamster Response
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: The vaccine induced an IgG antibody response and, additionally, conferred sterilizing immunity in 80% of the surviving animals (Forster et al., 2013).
  • Efficacy: Immunization with a DNA vaccine encoding LigBrep resulted in the survival of 5/8 (62.5%) hamsters against lethal infection (P < 0.05). None of the control hamsters or animals immunized with the other vaccine preparations survived (Forster et al., 2013).
113. Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4989.00)
a. Manufacturer:
Colorado Serum Company
b. Vaccine Ontology ID:
VO_0002295
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cattle
114. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.20)
a. Manufacturer:
Wyeth, Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002321
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
115. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.21)
a. Manufacturer:
Intervet Inc., Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002322
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
116. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002323
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
117. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.01)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002277
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
118. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.20)
a. Manufacturer:
Pfizer, Inc., Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0002278
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
119. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.21)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Pfizer, Inc., Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0002279
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
120. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002280
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
121. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.01)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002292
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
122. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.20)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0002293
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
123. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.22)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0002294
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
124. Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4960.00)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002291
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
125. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002309
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
126. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.23)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002310
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
127. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.24)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002311
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
128. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002312
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
129. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.23)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002313
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
130. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.24)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002314
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
131. Porcine Reproductive & Respiratory Syndrome-Parvovirus Reproductive Form, Modified Live & Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4P19.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002324
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
132. Trichomonas Foetus Vaccine, Killed Protozoa-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4990.00)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002296
c. Status:
Licensed
d. Location Licensed:
USA
e. Host Species for Licensed Use:
Cattle
IV. References
1. Forster et al., 2013: Forster KM, Hartwig DD, Seixas FK, Bacelo KL, Amaral M, Hartleben CP, Dellagostin OA. A Conserved Region of Leptospiral Immunoglobulin-Like A and B Proteins as a DNA Vaccine Elicits a Prophylactic Immune Response against Leptospirosis. Clinical and vaccine immunology : CVI. 2013; 20(5); 725-731. [PubMed: 23486420].
2. Maneewatch et al., 2007: Maneewatch S, Tapchaisri P, Sakolvaree Y, Klaysing B, Tongtawe P, Chaisri U, Songserm T, Wongratanacheewin S, Srimanote P, Chongsa-nguanz M, Chaicumpa W. OmpL1 DNA vaccine cross-protects against heterologous Leptospira spp. challenge. Asian Pacific journal of allergy and immunology / launched by the Allergy and Immunology Society of Thailand. 2007; 25(1); 75-82. [PubMed: 17891923].
3. Wiki: Leptospirosis: Wiki: Leptospirosis [http://en.wikipedia.org/wiki/Leptospirosis]