VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Porcine parvovirus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. non-structural protein 1 (Protective antigen)
    2. VP1 (Protective antigen)
    3. VP2 (Protective antigen)
  3. Vaccine Information
    1. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae Bacterin (USDA: 4906.20)
    2. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.20)
    3. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.21)
    4. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.22)
    5. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.01)
    6. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.20)
    7. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.21)
    8. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.22)
    9. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.01)
    10. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.20)
    11. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.22)
    12. Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4960.00)
    13. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.22)
    14. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.23)
    15. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.24)
    16. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.22)
    17. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.23)
    18. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.24)
    19. Porcine Reproductive & Respiratory Syndrome-Parvovirus Reproductive Form, Modified Live & Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4P19.20)
  4. References
I. General Information
1. NCBI Taxonomy ID:
10796
2. Disease:
SMEDI, reproductive failure
3. Introduction
Porcine parvovirus (PPV) is the cause of reproductive failure in swine characterized by embryonic and fetal infection and death (SMEDI), generally without outward maternal clinical signs. The virus is ubiquitous throughout the world and is endemic in most swine herds. PPV can also potentiate the effects of infection with porcine circovirus type 2. The most common routes of infection for postnatal and prenatal pigs are oronasal and transplacental. Infection is endemic in most herds, and generally sows are immune. The virus can persist in the environment, as it is themostable and resistant to many common disinfectants. The major and usually only clinical response of PPV infection is maternal reproductive failure, such as infertility, abortion, stillbirth, neonatal death and reduced neonatal vitality (Mengeling, 2006).
4. Host Ranges and Animal Models
Pigs
1. non-structural protein 1
  • Gene Name : non-structural protein 1
  • Sequence Strain (Species/Organism) : Porcine parvovirus
  • NCBI Protein GI : AAS93262
  • Other Database IDs : CDD:255001
    CDD:289218
    CDD:279406
    CDD:288933
  • Taxonomy ID : 10796
  • Protein Name : non-structural protein 1
  • Protein pI : 6.85
  • Protein Weight : 73222.28
  • Protein Length : 731
  • Protein Note : Rep protein catalytic domain like; pfam08724
  • Protein Sequence : Show Sequence
    >AAS93262.1 non-structural protein 1 [Porcine parvovirus]
    MAAGNTYSEEVLKATDWLQDNAQKEAFSYVFKTQKVNLNGKEIAWNNYNKDTTDAEMINLQRGAETSWDQ
    ATDMEWESEIDSLTKRQVLIFDSLVKKCLFEGILQKNLSPSDCYWFIQHEHGQDTGYHCHVLLGGKGLQQ
    AMGKWFRKQLNNLWSRWLIMQCKVPLTPVERIKLRELAEDGEWVSLLTYTHKQTKKQYTKMTHFGNMIAY
    YFLNKKRKTTEREHGYYLSSDSGFMTNFLKEGERHLVSHLFTEANKPETVETTVTTAQEAKRGRIQTKKE
    VSIKCTIRDLVNKGCTSIEDWMMTDPDSYIEMMAQTGGENLIKNTLEITTLTLARTKTAYDLILEKAKPS
    MLPTFNISNTRTCKIFSMHNWNYIKVCHAITCVLNRQGGKRNTILFHGPASTGKSIIAQHIANLVGNVGC
    YNAANVNFPFNDCTNKNLIWIEEAGNFSNQVNQFKAICSGQTIRIDQKGKGSKQIEPTPVIMTTNEDITK
    VRVGCEERPEHTQPIRDRMLNINLTRKLPGDFGLLEETEWPLICAWLVKKGYQATMASYMHHWGNVPDWS
    EKWEEPKMQTPINTPTDSQISTSVKTSPADNNYAATPIQEDLDLALALEPWSEPTTPTFTNLHLTPTPPD
    SAIRTPSPTWSEIETDIRACFGENCAPTTNLE
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Qi and Cui, 2009)
2. VP1
  • Gene Name : VP1
  • Sequence Strain (Species/Organism) : Porcine parvovirus
  • NCBI Protein GI : AFR43265
  • Other Database IDs : CDD:285583
    CDD:279128
  • Taxonomy ID : 10796
  • Protein Name : VP1 protein
  • Protein pI : 8.35
  • Protein Weight : 79417.77
  • Protein Length : 786
  • Protein Note : Parvovirus coat protein VP1; pfam08398
  • Protein Sequence : Show Sequence
    >AFR43265.1 VP1 protein [Porcine parvovirus]
    MAPPAKRARGLTLPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYDKYIKSGKNPYFYFSAADEKFIKET
    EHAKDYGGKIGHYFFRAKRAFAPKLSETDSPTTSQQPEVRRSPRKHPGSKPPGKRPAPRHIFINLAKKKA
    KGTSNTNSNSMSENVEQHNPINAGTELSATGNESGGGGGGGGGRGAGGVGVSTGTFNNQTEFQYLGEGLV
    RITAHASRLIHLNMPEHETYKRIHVLNSESGVAGQMVQDDAHTQMVTPWSLIDANAWGVWFNPADWQLIS
    NNMTEINLVSFEQEIFNVVLKTITESATSPPTKIYNNDLTASLMVALDTNNTLPYTPAAPRSETLGFYPW
    LPTKPTQYRYYLSCIRNLNPPTYTGQSQQITDSIQTGLHSDIMFYTIENAVPIHLLRTGDEFSTGIYHFD
    TKPLKLTHSWQTNRSLGLPPKLLTEPTTEGDQHSGTLPAANTRKGYHQTINNSYTEATAIRPAQVGYNTP
    YMNFEYSNGGPFLTPIVPTADTQYNDDEPNGAIRFTMDYQHGHLTTSSQELERYTFNPQSKCGRAPKQQF
    NQQAPLNLENTNNGTLLPSDPIGGKSNMHFMNTLNTYGPLTALNNTAPVFPNGQIWDKELDTDLKPRLHV
    TAPFVCKNNPPGQLFVKIAPNLTDDFNADSPQQPRIITYSNFWWKGTLTFTAKMRSSNMWNPIQQHTTTA
    ENIGNYIPTNIGGIRMFPEYSQLIPRKLY
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Xie et al., 2010)
3. VP2
  • Gene Name : VP2
  • Sequence Strain (Species/Organism) : Porcine parvovirus
  • NCBI Protein GI : AGZ94859
  • Other Database IDs : CDD:279128
  • Taxonomy ID : 10796
  • Protein Name : VP2
  • Protein pI : 6.16
  • Protein Weight : 62794.25
  • Protein Length : 626
  • Protein Note : Parvovirus coat protein VP2; pfam00740
  • Protein Sequence : Show Sequence
    >AGZ94859.1 VP2 [Porcine parvovirus]
    MSENVEQHNPINAGTELSATGNESGGGGGGGGGRGAGGVGVSTGTFNNQTEFQYLGEGLVRITAHASRLI
    HLNMPEHETYKRIHVLNSESGVAGQMVQDDAHTQMVTPWSLIDANAWGVWFNPADWQLISNNMTEINLVS
    FEQEIFNVVLKTITESATSPPTKIYNNDLTASLMVALDTNNTLPYTPAAPRSETLGFYPWLPTKPTQYRY
    YLSCIRNLNPPTYTGQSQQITDSIQTGLHSDIMFYTIENAVPIHLLRTGDEFSTGIYHFDTKPLKLTHSW
    QTNRSLGLPPKLLTEPTTEGDQHPGTLPAANTRKGYHQTMNNSYTEATAIRPAQVGYNTPYMNFEYSNGG
    PFLTPIVPTADTQYNDDEPNGAIRFTMDYQHGHLTTSSQELERYTFNPQSKCGRAPKQQFNQQAPLNLEN
    TNNGTLLPSDPIGGKSNMHFMNTLNTYGPLTALNNTAPVFPNGQIWDKELDTDLKPRLHVTAPFVCKNNP
    PGQLFVKIAPNLTDDFNADSPQQPRIITYSNFWWKGTLTLTAKMRSSNMWNPIQQHTTTAENIGNYIPTN
    IGGMRMFPEYSQLIPRKLY
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Ji et al., 2017)
III. Vaccine Information
1. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae Bacterin (USDA: 4906.20)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0002290
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
2. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.20)
a. Manufacturer:
Wyeth, Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002321
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
3. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.21)
a. Manufacturer:
Intervet Inc., Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002322
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
4. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002323
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
5. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.01)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002277
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
6. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.20)
a. Manufacturer:
Pfizer, Inc., Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0002278
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
7. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.21)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Pfizer, Inc., Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0002279
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
8. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002280
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
9. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.01)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002292
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
10. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.20)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0002293
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
11. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.22)
a. Manufacturer:
Novartis Animal Health US, Inc.
b. Vaccine Ontology ID:
VO_0002294
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
12. Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4960.00)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002291
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
13. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002309
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
14. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.23)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002310
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
15. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.24)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002311
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
16. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002312
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
17. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.23)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002313
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
18. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.24)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002314
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
19. Porcine Reproductive & Respiratory Syndrome-Parvovirus Reproductive Form, Modified Live & Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4P19.20)
a. Manufacturer:
Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002324
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
IV. References
1. Ji et al., 2017: Ji P, Liu Y, Chen Y, Wang A, Jiang D, Zhao B, Wang J, Chai S, Zhou E, Zhang G. Porcine parvovirus capsid protein expressed in Escherichia coli self-assembles into virus-like particles with high immunogenicity in mice and guinea pigs. Antiviral research. 2017; 139; 146-152. [PubMed: 28063996].
2. Qi and Cui, 2009: Qi T, Cui SJ. Expression, purification, and characterization of recombinant NS-1, the porcine parvovirus non-structural protein. Journal of virological methods. 2009; 157(1); 93-97. [PubMed: 19101593].
3. Xie et al., 2010: Xie HL, Wang Z, Cui SJ, Zhang CF, Cui YD. The epitope of the VP1 protein of porcine parvovirus. Virology journal. 2010; 7; 161. [PubMed: 20637107].