VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Chlamydia trachomatis

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
    5. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. COMC (Protective antigen)
    2. CPAF (Protective antigen)
    3. eno (Protective antigen)
    4. groEL_3 (Protective antigen)
    5. htrA (Protective antigen)
    6. incA (Protective antigen)
    7. ligA (Protective antigen)
    8. omcB (Protective antigen)
    9. omp1 (Protective antigen)
    10. ompA (Protective antigen)
    11. ompA (Protective antigen)
    12. pmpD (Protective antigen)
    13. srp (Protective antigen)
    14. tarP (Protective antigen)
  3. Vaccine Information
    1. C. trachomatis DNA vaccine pWRG7079::MOMP
    2. rVCG- Chlamydia-cholera
    3. rVCG- MOMP/HSV-2-gD
    4. Synthetic OMP1 Vaccine
  4. References
I. General Information
1. NCBI Taxonomy ID:
813
2. Disease:
Chlamydia
3. Introduction
Sexually transmitted Chlamydia trachomatis infection is a widespread public health concern because of its prevalence and potentially devastating reproductive consequences, including pelvic inflammatory disease (PID), infertility, and ectopic pregnancy. Although the pathologic consequences of infection are well established, the mechanism(s) of chlamydia-induced tissue damage are not fully understood (Darville and Hiltke, 2010).
4. Host Ranges and Animal Models
Chlamydia infects humans and there are established animal models in mice and guinea pigs (Darville and Hiltke, 2010).
5. Host Protective Immunity
Mouse and guinea pig models show that the response to primary chlamydial in fection occurs within 1–2 days of infection and is characterized by mucosal infiltration with neutrophils and modest numbers of monocytes. Neutrophils are recruited in large numbers to the site of infection and are capable of killing accessible elementary bodies. Later, T cells accumulate at the site of chlamydial infection and play a critical role in controlling the infection (Darville and Hiltke, 2010).
1. COMC
  • Gene Name : COMC
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis
  • NCBI Protein GI : CRH78535
  • Taxonomy ID : 813
  • Protein Name : COMC family
  • Protein pI : 9.5
  • Protein Weight : 6185.97
  • Protein Length : 99
  • Protein Sequence : Show Sequence
    >CRH78535.1 COMC family [Chlamydia trachomatis]
    MKKLFAKKEVVKKEIVEFKELNDEQLDKIIGGDRRDPRGMIGIGKKLFG
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Pal et al., 1997)
2. CPAF
  • Gene Name : CPAF
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis
  • NCBI Protein GI : WP_009873463
  • Other Database IDs : CDD:321971
    CDD:214582
  • Taxonomy ID : 813
  • Protein Name : protease-like activity factor CPAF
  • Protein pI : 6.04
  • Protein Weight : 63818.54
  • Protein Length : 686
  • Protein Note : C-terminal processing peptidase family S41; cl02526
  • Protein Sequence : Show Sequence
    >WP_009873463.1 protease-like activity factor CPAF [Chlamydia trachomatis]
    MKMNRIWLLLLTFSSAIHSPVRGESLVCKNALQDLSFLEHLLQVKYAPKTWKEQYLGWDLVQSSVSAQQK
    LRTQENPSTSFCQQVLADFIGGLNDFHAGVTFFAIESAYLPYTVQKSSDGRFYFVDIMTFSSEIRVGDEL
    LEVDGAPVQDVLATLYGSNHKGTAAEESAALRTLFSRMASLGHKVPSGRTTLKIRRPFGTTREVRVKWRY
    VPEGVGDLATIAPSIRAPQLQKSMRSFFPKKDDAFHRSSSLFYSPMVPHFWAELRNHYATSGLKSGYNIG
    STDGFLPVIGPVIWESEGLFRAYISSVTDGDGKSHKVGFLRIPTYSWQDMEDFDPSGPPPWEEFAKIIQV
    FSSNTEALIIDQTNNPGGSVLYLYALLSMLTDRPLELPKHRMILTQDEVVDALDWLTLLENVDTNVESRL
    ALGDNMEGYTVDLQVAEYLKSFGRQVLNCWSKGDIELSTPIPLFGFEKIHPHPRVQYSKPICVLINEQDF
    SCADFFPVVLKDNDRALIVGTRTAGAGGFVFNVQFPNRTGIKTCSLTGSLAVREHGAFIENIGVEPHIDL
    PFTANDIRYKGYSEYLDKVKKLVCQLINNDGTIILAEDGSF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Skwor et al., 2010)
3. eno
  • Gene Name : eno
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis
  • NCBI Protein GI : AKR39796
  • Other Database IDs : CDD:213580
  • Taxonomy ID : 813
  • Protein Name : enolase
  • Protein pI : 4.42
  • Protein Weight : 43780.09
  • Protein Length : 476
  • Protein Note : phosphopyruvate hydratase; TIGR01060
  • Protein Sequence : Show Sequence
    >AKR39796.1 enolase [Chlamydia trachomatis]
    MFDVVISDIEAREILDSRGYPTLCVKVITNTGTFGEACVPSGASTGIKEALELRDKDPKRYQGKGVLQAI
    SNVEKVLVPALQGFSVFDQITADAIMIDADGTPNKEKLGANAILGVSLALAKAAANTLQRPLYRYLGGSF
    SHVLPCPMMNLINGGMHATNGLQFQEFMIRPISAPSLTEAVRMGAEVFNALKKILQNRQLATGVGDEGGF
    APNLASNAEALDLLLTAIETAGFTPREDISLALDCAASSFYNTQDKTYDGKSYADQVGILAELCEHYPID
    SIEDGLAEEDFEGWKLLSETLGDRVQLVGDDLFVTNSALIAEGIAQGLANAVLIKPNQIGTLTETAEAIR
    LATIQGYATILSHRSGETEDTTIADLAVAFNTGQIKTGSLSRSERIAKYNRLMAIEEEMGPEALFQDSNP
    FSKA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Goodall et al., 2001)
4. groEL_3
  • Gene Name : groEL_3
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis D/UW-3/CX
  • NCBI Protein GI : AAC68350
  • Other Database IDs : CDD:223535
  • Taxonomy ID : 272561
  • Protein Name : HSP60
  • Protein pI : 7.47
  • Protein Weight : 54193.952
  • Protein Length : 573
  • Protein Note : Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones]; COG0459
  • Protein Sequence : Show Sequence
    >AAC68350.1 HSP60 [Chlamydia trachomatis D/UW-3/CX]
    MPHDNNEMHRNTIHQLFTGLDKAYQIVKGFYGPAYSSSSKDFFKGRGYHILSRIELSDPFERIGVYFARS
    LAKRIHKRHADGVISSVILLRAFLKASIPFIDQGLSPRLLASALASQKEAVCAYLHSHSFLLKDASKVLG
    LIRSHLPDPLIGEAFAEAVAYTGHEGAVALSQRSGSTLHLVKGIQTQKGYRVPSFFPHDSFHENPIVAPK
    IFVTDQKIHCLFPFLPLLKKFSEEQTPLIIFCKEIAPDPLATCIANRIAGLLDVLVVTIPDTTLLEDIAL
    LTGTTVFSSPPFSNKPPIELPLLGSCTWAELSRDHTLLVCENLVPEVVKLKVRQLDHAIHNAEDETSRKL
    LKKRKHRLENSIAIIPVKQDTTPLHELALKTLNSTQESGFVLGGGAALLYATQSLSSSPEHSQEEQAAVQ
    ILQTACRTLLEQLVNSVYMDGKLVADKLCSLGTPSLGFNVVSQQIEDMISAGIITPLNVVLDIFSCSLHT
    AVDLLLASFTTPPTPAAKEKKT
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Skwor et al., 2010)
5. htrA
  • Gene Name : htrA
  • Sequence Strain (Species/Organism) : Chlamydia muridarum str. Nigg
  • NCBI Protein GI : AAF39082
  • Other Database IDs : CDD:273938
  • Taxonomy ID : 243161
  • Protein Name : serine protease, HtrA/DegQ/DegS family
  • Protein pI : 6.42
  • Protein Weight : 49196.88
  • Protein Length : 589
  • Protein Note : periplasmic serine protease, Do/DeqQ family; TIGR02037
  • Protein Sequence : Show Sequence
    >AAF39082.1 serine protease, HtrA/DegQ/DegS family [Chlamydia muridarum str. Nigg]
    MMKRLLCVLLSTSVFSSPMLGYSAPKKDSSTGICLAASQSDRELSQEDLLKEVSRGFSKVAAQATPGVVY
    IENFPKTGSQAIASPGNKRGFQENPFDYFNDEFFNRFFGLPSHREQPRPQQRDAVRGTGFIVSEDGYVVT
    NHHVVEDAGKIHVTLHDGQKYTAKIIGLDPKTDLAVIKIQAKNLPFLTFGNSDQLQIGDWSIAIGNPFGL
    QATVTVGVISAKGRNQLHIVDFEDFIQTDAAINPGNSGGPLLNIDGQVIGVNTAIVSGSGGYIGIGFAIP
    SLMAKRVIDQLISDGQVTRGFLGVTLQPIDSELAACYKLEKVYGALITDVVKGSPAEKAGLRQEDVIVAY
    NGKEVESLSALRNAISLMMPGTRVVLKVVREGKFIEIPVTVTQIPAEDGVSALQKMGVRVQNLTPEICKK
    LGLASDTRGIFVVSVEAGSPAASAGVVPGQLILAVNRQRVSSVEELNQVLKNAKGENVLLMVSQGEVIRF
    VVLKSDE
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Bartolini et al., 2013)
6. incA
  • Gene Name : incA
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis
  • NCBI Protein GI : ABV03238
  • Other Database IDs : CDD:282066
  • Taxonomy ID : 813
  • Protein Name : IncA
  • Protein pI : 7.95
  • Protein Weight : 29755.22
  • Protein Length : 319
  • Protein Note : IncA protein; pfam04156
  • Protein Sequence : Show Sequence
    >ABV03238.1 IncA [Chlamydia trachomatis]
    MTTPTLIVTPPSPPAPSYSANRVPQPSLMDKIKKIAAIASLILIGTIGFLALLGHLVGFLIAPQITIVLL
    ALFITSLAGNALYLQKTANLHLYQDLQREVGSLKEINFMLSVLQKEFLHLSKEFATTSKDLSAVSQDFYS
    CLQGFRDNYKGFESLLDEYKNSTEEMRKLFSQEIIADLKSSVASLREEIRFLTPLAEEVCRLAHNRESLT
    AAIEELKTIRDSLRDEIGQLSQLSKTLTSQIALQRKESSDLCSQIRETLSSPRKSALPSTKSS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Tsai et al., 2007)
7. ligA
  • Gene Name : ligA
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis
  • NCBI Protein GI : CRH83817
  • Taxonomy ID : 813
  • Protein Name : NAD-dependent DNA ligase LigA
  • Protein pI : 5.14
  • Protein Weight : 72199.57
  • Protein Length : 739
  • Protein Sequence : Show Sequence
    >CRH83817.1 NAD-dependent DNA ligase LigA [Chlamydia trachomatis]
    MDERKRIEELRELLEKYSLEYYVKDDPSVSDQEYDRLLEELIHLEDKHPEMYDANSPSQRIIGSVLDGFE
    KVQHTSMMLSLSDIFNLEEIQEFCSRMEELSDHPEFVVECKYDGLAMSLTYENGEFIRAVTRGDGSVGED
    VSNNIRTIASIPMHIPTKEHVEVRGEVYMPKESFERLNEIQEKQGKKPFANPRNAAAGSIRQLDSAICAS
    RKLDAYWYYFQNAQDFGILTQEEALEKMEALHFRVNPMRKICQNAQEVWDFIQEIGQKRDSLPYEIDGMV
    LKLNSLVDSRRIGTTAKVPRYAIAYKFPAQRVETRLIDITLTVGRTGKVTPNAVLEPVRVAGTTVQAATL
    HNEDMIRNKDLRIGDMVVIHKAGEIIPEVVEALPERRDGRQKPYVFPQTCPVCHAKLVRLENESSHYCIN
    QDCPARVVESMIHFASRDAMNIETLGDKKIEQLHEWGYLNSIEDIYFLYQHREALIGKPGYQEKSVDKLL
    EQIEASKKNELGLLLFALGIRQVGKKAAMILADHFLSMDALMQASLEELTGLKDIGQITAESILSFFAEE
    KNQHLINVLQSCGLCMEQTKKEQKVSRFTNKTCVLTGTLEHYTRKEAKAILESLGANVAGSVSKKTDFVI
    YGSAAGSKLTKAQQLGVATMTEEEFMQEVENA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Patel et al., 2014)
8. omcB
  • Gene Name : omcB
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis
  • NCBI Protein GI : ABY76794
  • Other Database IDs : CDD:281500
    CDD:307488
  • Taxonomy ID : 813
  • Protein Name : OmcB
  • Protein pI : 7.22
  • Protein Weight : 52087.75
  • Protein Length : 597
  • Protein Note : Chlamydia cysteine-rich outer membrane protein 6; pfam03504
  • Protein Sequence : Show Sequence
    >ABY76794.1 OmcB [Chlamydia trachomatis]
    MNKLIRRAVTIFAVTSVASLFASGVLETSMAESLSTNVISLADTKAKDNTSHKSKKARKNHSKETPVDRK
    EVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQL
    PCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKPLKEGCCFTAATVCACPEIRSVTKCGQPA
    ICVKQEGPENACLRCPVVYKINIVNQGTATARNVVVENPVPDGYAHSSGQRVLTFTLGDMQPGEHRTITV
    EFCPLKRGRATNIATVSYCGGHKNTASVTTVINEPCVQVSIAGADWSYVCKPVEYVISVSNPGDLVLRDV
    VVEDTLSPGVTVLEAAGAQISCNKVVWTVKELNPGESLQYKVLVRAQTPGQFTNNVVVKSCSDCGTCTSC
    AEATTYWKGVAATHMCVVDTCDPVCVGENTVYRICVTNRGSAEDTNVSLMLKFSKELQPVSFSGPTKGTI
    TGNTVVFDSLPRLGSKETVEFSVTLKAVSAGDARGEAILSSDTLTVPVSDTENTHIY
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Gervassi et al., 2004)
9. omp1
  • Gene Name : omp1
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis
  • NCBI Protein GI : AAB34697
  • Taxonomy ID : 813
  • Protein Name : major outer membrane protein
  • Protein pI : 4.18
  • Protein Weight : 2471.36
  • Protein Length : 98
  • Protein Note : MOMP
  • Protein Sequence : Show Sequence
    >AAB34697.1 major outer membrane protein, partial [Chlamydia trachomatis]
    NNENQTKVSNGTFVPNMSLDQS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Jiang et al., 2017)
10. ompA
  • Gene Name : ompA
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis serovar E
  • NCBI Protein GI : 129149
  • Other Database IDs : CDD:279628
  • Taxonomy ID : 813
  • Gene Strand (Orientation) : ?
  • Protein Name : Major outer membrane porin, serovar E
  • Protein pI : 4.97
  • Protein Weight : 42587.71
  • Protein Length : 507
  • Protein Note : MOMP
  • Protein Sequence : Show Sequence
    >sp|P17451.1|MOMPE_CHLTH RecName: Full=Major outer membrane porin, serovar E; Short=MOMP; Flags: Precursor
    MKKLLKSVLVFAALSSASSLQALPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVF
    DRVLKTDVNKEFQMGDKPTSTTGNATAPTTLTARENPAYGRHMQDAEMFTNAACMALNIWDRFDVFCTLG
    ASSGYLKGNSASFNLVGLFGDNENQSTVKTNSVPNMSLDQSVVELYTDTAFSWSVGARAALWECGCATLG
    ASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGQEFPLALIAGTDAATGTKDASIDYHEWQASLALSYR
    LNMFTPYIGVKWSRASFDADTIRIAQPKSATAIFDTTTLNPTIAGAGDVKASAEGQLGDTMQIVSLQLNK
    MKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): C. trachomatis DNA vaccine pWRG7079::MOMP
11. ompA
  • Gene Name : ompA
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis
  • NCBI Protein GI : ABV55512
  • Other Database IDs : CDD:279628
  • Taxonomy ID : 813
  • Protein Name : OmpA
  • Protein pI : 4.37
  • Protein Weight : 32434.51
  • Protein Length : 368
  • Protein Note : Chlamydia major outer membrane protein; pfam01308
  • Protein Sequence : Show Sequence
    >ABV55512.1 OmpA, partial [Chlamydia trachomatis]
    ILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVFDRVLKTDVNKEFQMGDKPTSTTGNATAPTTLTARENP
    AYGRHMQDAEMFTNAACMALNIWDRFDVFCTLGASSGYLKGNSASFNLVGLFGDNENQSTVKTNSVPNMS
    LDQSVVELYTDTAFSWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGQEF
    PLALIAGTDAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDADTIRIAQPKSATAIFDTT
    TLNPTIAGAGDVKASAEGQLGDTMQIVSLQLN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Patel et al., 2014)
12. pmpD
  • Gene Name : pmpD
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis
  • NCBI Protein GI : AAK69391
  • Other Database IDs : CDD:311484
    CDD:309066
  • Taxonomy ID : 813
  • Protein Name : polymorphic membrane protein D
  • Protein pI : 4.5
  • Protein Weight : 150192.86
  • Protein Length : 1620
  • Protein Note : Chlamydia polymorphic membrane protein middle domain; pfam07548
  • Protein Sequence : Show Sequence
    >AAK69391.2 polymorphic membrane protein D [Chlamydia trachomatis]
    MSSEKDIKSTCSKFSLSVVAAILASVSGLASCVDLHAGGQSVNELVYVGPQAVLLLDQIRDLFVGSKDSQ
    AEGQYRLIVGDPSSFQEKDADTLPGKVEQSTLFSVTNPVVFQGVDQQDQVSSQGLICSFTSSNLDSPRDG
    ESFLGIAFVGDSSKAGITLTDVKASLSGAALYSTEDLIFEKIKGGLEFASCSSLEQGGACAAQSILIHDC
    QGLQVKHCTTAVNAEGSSANDHLGFGGGAFFVTGSLSGEKSLYMPAGDMVVANCDGAISFEGNSANFANG
    GAIAASGKVLFVANDKKTSFIENRALSGGAIAASSDIAFQNCAELVFKGNCAIGTEDKGSLGGGAISSLG
    TVLLQGNHGITCDKNESASQGGAIFGKNCQISDNEGPVVFRDSTACLGGGAIAAQEIVSIQNNQAGISFE
    GGKASFGGGIACGSFSSAGGASVLGTIDISKNLGAISFSRTLCTTSDLGQMEYQGGGALFGENISLSENA
    GVLTFKDNIVKTFASNGKILGGGAILATGKVEITNNSGGISFTGNARAPQALPTQEEFPLFSKKEGRPLS
    SGYSGGGAILGREVAILHNAAVVFEQNRLQCSEEEATLLGCCGGGAVHGMDSTSIVGNSSVRFGNNYAMG
    QGVSGGALLSKTVQLAGNGSVDFSRNIASLGGGALQASEGNCELVDNGYVLFRDNRGRVYGGAISCLRGD
    VVISGNKGRVEFKDNIATRLYVEETVEKVEEVEPAPEQKDNNELSFLGSVEQSFITAANQALFASEDGDL
    SPESSISSEELAKRRECAGGAIFAKRVRIVDNQEAVVFSNNFSDIYGGAIFTGSLREEDKLDGQIPEVLI
    SGNAGDVVFSGNSSKRDEHLPHTGGGAICTQNLTISQNTGNVLFYNNVACSGGAVRIEDHGNVLLEAFGG
    DIVFKGNSSFRAQGSDAIYFAGKESHITALNATEGHAIVFHDALVFENLKERKSAEVLLINSRENPGYTG
    SIRFLEAESKVPQCIHVQQGSLELLNGATLCSYGFKQDAGAKLVLAAGSKLKILDSGTPVQGHAISKPEA
    EIESSSEPEGAHSLWIAKNAQTTVPMVDIHTISVDLASFSSSQQEGTVEAPQVIVPGGSYVRSGELNLEL
    VNTTGTGYENHALLKNEAKVPLMSFVASSDEASAEISNLSVSDLQIHVATPEIEEDTYGHMGDWSEAKIQ
    DGTLVINWNPTGYRLDPQKAGALVFNALWEEGAVLSALKNARFAHNLTAQRMEFDYSTNVWGFAFGGFRT
    LSAENLVAIDGYKGAYGGASAGVDIQLMEDFVLGVSGAAFLGKMDSQKFDAEVSRKGVVGSVYTGFLAGS
    WFFKGQYSLGETQNDMKTRYGVLGESSASWTSRGVLADALVEYRSLVGPVRPTFYALHFNPYVEVSYASM
    KFPGFTEQGREARSFEDASLTNITIPLGMKFELAFIKGQFSEVNSLGISYAWEAYRKVEGGAVQLLEAGF
    DWEGAPMDLPRQELRVALENNTEWSSYFSTVLGLTAFCGGFTSTDSKLGYEANAGLRLIF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Paes et al., 2016)
13. srp
  • Gene Name : srp
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis
  • NCBI Protein GI : P18587
  • Other Database IDs : CDD:253365
  • Taxonomy ID : 813
  • Protein Name : Sulfur-rich protein, serovars L1/L3
  • Protein pI : 7.21
  • Protein Weight : 16877.72
  • Protein Length : 326
  • Protein Note : 15 kDa cysteine-rich outer membrane protein; Cysteine-rich protein A
  • Protein Sequence : Show Sequence
    >sp|P18587.1|SRPL_CHLTH RecName: Full=Sulfur-rich protein, serovars L1/L3; AltName: Full=15 kDa cysteine-rich outer membrane protein; AltName: Full=Cysteine-rich protein A
    MSTVPVVQGAGSSNSAQDISTSSVPLTLQGRISNLLSSTAFKVGLVVMGLLLVMATIFLVSAASFVNPIY
    LAIPAIVGCVNICVGILSMEGYCSPERWSLCKKVLKASEDIIDDGQINNSNKVFTDERLNAIGGVVESLS
    RRNSLVDQTQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Starnbach et al., 2003)
14. tarP
  • Gene Name : tarP
  • Sequence Strain (Species/Organism) : Chlamydia trachomatis
  • NCBI Protein GI : ADK74121
  • Other Database IDs : CDD:284902
  • Taxonomy ID : 813
  • Protein Name : TarP
  • Protein pI : 3.79
  • Protein Weight : 115358.02
  • Protein Length : 1225
  • Protein Note : Domain of Unknown Function (DUF1547); pfam07577
  • Protein Sequence : Show Sequence
    >ADK74121.1 TarP [Chlamydia trachomatis]
    MTNSISGDQPTVTTFTSSTTSASGASGSLGASSVSTTANATVTQTANATNSAATSSIQTTGETVVNYTNS
    ASAPTVTVSTSSSSTQATATSNKTSQAVAGKITSPDTSESSETSSTSSSDHIPSDYEPISTTENIYENTY
    ESMGGSSTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPISTTENIYENTYESIGGSSTSGPENTSG
    GAAAALNSLRGSSYSNYDDAAADYEPISTTENIYESIDDSSTSDPENTSGGAAAALNSLRGSSYSNYDDA
    AADYEPISTTENIYESIDDSSTSGPENTSGGAAALNSLRGSSYSNYDDAAADYEPISTTENIYESIDDSS
    TSDPENTSGGAAAALNSLRGSSYSNYDDAAADYEPISTTENIYESIDDSSTSGPENTSGGAAALNSLRGS
    SYSNYDDAAADYEPISTTENIYESIDDSSTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPISTTEN
    IYENIYESIGGSSTSDPENTSGGAAAALNSLRGSSYSNYDDAAADYEPISTTENIYENIYESIGGSSTSD
    PENTSGGAAAALNSLRVSSLRGSSYTTGPRNEGVFGPGPEGLPDMSLPSYDPTNKTSLLTFLSNPHVKSK
    MLENSGHFVFIDTDRSSFILVPNGNWDQVCSIKVQNGKTKEDLDIKDLENMCAKFCTGFNQFSGDWDSRV
    EPMMSAKAGVASGGNLPNTVIINNKFKTCVAYGPWNSQEASSGYTPSAWRRGHQVNFGEIFEKPNDFNKI
    NWGTQAGPSSEDDGISFSNETPGAGPAAAPSPTPSSIPVINVNVNVGGTNVNIRDTNVNTTNTTPTTQST
    DASTDTSDIDNINTNNQTDDINTTDKDSDGAGGVNGDISETESSSGDDSGSVSSSESDKNASVGNDGPAM
    KDILSAVRKHLDVVYPGDNGGSTEGPLQANQTLGDIVQDMETTGTSQETVVSPWKGSTSSTGSAGGSGSV
    QTLLPSPPPTPSTTTLRTGTGATTTSLMMGGPIKADIITTGGGGRIPGGGTLEKLLPRIRAHLDISFDAQ
    GDLVSTEEPQLGSIVNKFRQETGSGGIVASVESAPGKPGSAQVLTGTGGDKGNLFQAAAAVTQALGNVAG
    KVNLAIQGQKLSSLVNDDGKGSVGRDLFQAATQTTQALSSLIDTVG
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Wang et al., 2009)
III. Vaccine Information
1. C. trachomatis DNA vaccine pWRG7079::MOMP
a. Vaccine Ontology ID:
VO_0004554
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig
e. Antigen
ompA of C. trachomatis serovar E strain 468 (Schautteet et al., 2011)
f. Gene Engineering of ompA
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Vector:
pWRG7079 (Schautteet et al., 2011)
h. Immunization Route
Intravaginal injection
i. Pig Response
  • Vaccine Immune Response Type: VO_0003057
  • Efficacy: A good level of protection against C. trachomatis genital infection was observed in the immunized group. This group had no or only mild macroscopic lesions in comparison with the control group. The infection was mainly localized in the lower genital tract while in the placebo-primed group, C. trachomatis was spread throughout the lower and upper genital tract. The scores for chlamydial presence were significantly higher for the corpus uteri, the uterine tubes and the oviducts of the control group. No replication was detected outside the urogenital tract, which is in accordance with the literature. Induction of immune mechanisms that limited infection and replication also resulted in a decreased shedding by the vaccinated pigs in comparison with the control ones. Significant differences were seen at some time points from 10 days post infection until euthanasia (Schautteet et al., 2011).
2. rVCG- Chlamydia-cholera
a. Vaccine Ontology ID:
VO_0004720
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
A multisubunit vaccine candidate co-expressing the serovar D-derived Porin B and polymorphic membrane protein-D proteins of Chlamydia trachomatis (Eko et al., 2011; Chen et al., 1998).
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
  • Vaccination Protocol: Mice were immunized with rVCG constructs (Eko et al., 2011).
  • Vaccine Immune Response Type: VO_0003057
  • Efficacy: All vaccinated mice responded with a significant rise in vibriocidal antibody titer, the surrogate marker for protection in cholera (Eko et al., 2011).
3. rVCG- MOMP/HSV-2-gD
a. Vaccine Ontology ID:
VO_0004722
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
A bivalent combination vaccine formulation comprising rVCG expressing chlamydial MOMP and HSV-2 glycoprotein D (Macmillan et al., 2007).
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
  • Vaccination Protocol: Mice were immunized with the combination vaccine that elicited secretory IgA and IgG2a antibodies to both chlamydial and HSV-2 antigens in serum and vaginal secretions (Macmillan et al., 2007).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Immunized mice then experienced a genital challenge with high doses of live Chlamydia and HSV-2 (Macmillan et al., 2007).
  • Efficacy: Mice immunized with the combination vaccine were prophylactically protected (Macmillan et al., 2007).
4. Synthetic OMP1 Vaccine
a. Vaccine Ontology ID:
VO_0004240
b. Type:
Subunit vaccine
c. Status:
Research
d. Antigen
Lipidic amino acid-based synthetic peptides derived from the variable domains (VD) of Chlamydia trachomatis outer membrane protein 1 (Zhong et al., 1993).
e. Adjuvant: NAGO
f. Immunization Route
subcutaneous injection
g. Mouse Response
  • Vaccination Protocol: 50 μg of peptide was injected subcutaneously with NAGO in PBS into the tail base, and was repeated at 14 day intervals (Zhong et al., 1993).
  • Immune Response: NAGO elicited an antibody response similar to that in mice immunized with CFA (Zhong et al., 1993).
IV. References
1. Bartolini et al., 2013: Bartolini E, Ianni E, Frigimelica E, Petracca R, Galli G, Berlanda Scorza F, Norais N, Laera D, Giusti F, Pierleoni A, Donati M, Cevenini R, Finco O, Grandi G, Grifantini R. Recombinant outer membrane vesicles carrying Chlamydia muridarum HtrA induce antibodies that neutralize chlamydial infection in vitro. Journal of extracellular vesicles. 2013; 2; . [PubMed: 24009891].
2. Chen et al., 1998: Chen I, Finn TM, Yanqing L, Guoming Q, Rappuoli R, Pizza M. A recombinant live attenuated strain of Vibrio cholerae induces immunity against tetanus toxin and Bordetella pertussis tracheal colonization factor. Infection and immunity. 1998; 66(4); 1648-1653. [PubMed: 9529093].
3. Darville and Hiltke, 2010: Darville T, Hiltke TJ. Pathogenesis of genital tract disease due to Chlamydia trachomatis. The Journal of infectious diseases. 2010; 201 Suppl 2; S114-125. [PubMed: 20524234].
4. Eko et al., 2011: Eko FO, Okenu DN, Singh UP, He Q, Black C, Igietseme JU. Evaluation of a broadly protective Chlamydia-cholera combination vaccine candidate. Vaccine. 2011; 29(21); 3802-3810. [PubMed: 21421002].
5. Gervassi et al., 2004: Gervassi AL, Grabstein KH, Probst P, Hess B, Alderson MR, Fling SP. Human CD8+ T cells recognize the 60-kDa cysteine-rich outer membrane protein from Chlamydia trachomatis. Journal of immunology (Baltimore, Md. : 1950). 2004; 173(11); 6905-6913. [PubMed: 15557186].
6. Goodall et al., 2001: Goodall JC, Yeo G, Huang M, Raggiaschi R, Gaston JS. Identification of Chlamydia trachomatis antigens recognized by human CD4+ T lymphocytes by screening an expression library. European journal of immunology. 2001; 31(5); 1513-1522. [PubMed: 11465108].
7. Jiang et al., 2017: Jiang P, Cai Y, Chen J, Ye X, Mao S, Zhu S, Xue X, Chen S, Zhang L. Evaluation of tandem Chlamydia trachomatis MOMP multi-epitopes vaccine in BALB/c mice model. Vaccine. 2017; 35(23); 3096-3103. [PubMed: 28456528].
8. Macmillan et al., 2007: Macmillan L, Ifere GO, He Q, Igietseme JU, Kellar KL, Okenu DM, Eko FO. A recombinant multivalent combination vaccine protects against Chlamydia and genital herpes. FEMS immunology and medical microbiology. 2007; 49(1); 46-55. [PubMed: 17094789].
9. Paes et al., 2016: Paes W, Brown N, Brzozowski AM, Coler R, Reed S, Carter D, Bland M, Kaye PM, Lacey CJN. Recombinant polymorphic membrane protein D in combination with a novel, second-generation lipid adjuvant protects against intra-vaginal Chlamydia trachomatis infection in mice. Vaccine. 2016; 34(35); 4123-4131. [PubMed: 27389169].
10. Pal et al., 1997: Pal S, Theodor I, Peterson EM, de la Maza LM. Immunization with an acellular vaccine consisting of the outer membrane complex of Chlamydia trachomatis induces protection against a genital challenge. Infection and immunity. 1997; 65(8); 3361-3369. [PubMed: 9234798].
11. Patel et al., 2014: Patel AL, Mishra PK, Sachdev D, Chaudhary U, Patton DL, Saluja D. Seroprevalence of antibodies against Pkn1, a novel potential immunogen, in Chlamydia trachomatis-infected Macaca nemestrina and human patients. BioMed research international. 2014; 2014; 245483. [PubMed: 25032212].
12. Schautteet et al., 2011: Schautteet K, Stuyven E, Beeckman DS, Van Acker S, Carlon M, Chiers K, Cox E, Vanrompay D. Protection of pigs against Chlamydia trachomatis challenge by administration of a MOMP-based DNA vaccine in the vaginal mucosa. Vaccine. 2011; 29(7); 1399-1407. [PubMed: 21195805].
13. Skwor et al., 2010: Skwor T, Kandel RP, Basravi S, Khan A, Sharma B, Dean D. Characterization of humoral immune responses to chlamydial HSP60, CPAF, and CT795 in inflammatory and severe trachoma. Investigative ophthalmology & visual science. 2010; 51(10); 5128-5136. [PubMed: 20463311].
14. Starnbach et al., 2003: Starnbach MN, Loomis WP, Ovendale P, Regan D, Hess B, Alderson MR, Fling SP. An inclusion membrane protein from Chlamydia trachomatis enters the MHC class I pathway and stimulates a CD8+ T cell response. Journal of immunology (Baltimore, Md. : 1950). 2003; 171(9); 4742-4749. [PubMed: 14568950].
15. Tsai et al., 2007: Tsai PY, Hsu MC, Huang CT, Li SY. Human antibody and antigen response to IncA antibody of Chlamydia trachomatis. International journal of immunopathology and pharmacology. 2007; 20(1); 156-161. [PubMed: 17346439].
16. Wang et al., 2009: Wang J, Chen L, Chen F, Zhang X, Zhang Y, Baseman J, Perdue S, Yeh IT, Shain R, Holland M, Bailey R, Mabey D, Yu P, Zhong G. A chlamydial type III-secreted effector protein (Tarp) is predominantly recognized by antibodies from humans infected with Chlamydia trachomatis and induces protective immunity against upper genital tract pathologies in mice. Vaccine. 2009; 27(22); 2967-2980. [PubMed: 19428908].
17. Zhong et al., 1993: Zhong G, Toth I, Reid R, Brunham RC. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis. Journal of immunology (Baltimore, Md. : 1950). 1993; 151(7); 3728-3736. [PubMed: 7690812].