VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Human metapneumovirus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. F (Protective antigen)
    2. M (Protective antigen)
    3. P (Protective antigen)
    4. G protein (Virmugen)
    5. M2-2 (Virmugen)
  3. Vaccine Information
    1. Human metapneumovirus G protein mutant vaccine
    2. Human metapneumovirus M2-2 mutant vaccine
  4. References
I. General Information
1. NCBI Taxonomy ID:
162145
2. Disease:
Respiratory tract infection
3. Introduction
Human metapneumovirus is a negative single-stranded RNA virus belonging to the Paramyxoviridae family. Compared to human respiratory syncytial virus, HMPV is less severe and occurs in slightly older children. It can lead to hospitalization in children, elderly, and immunocompromised individuals (Wiki: Metapneumovirus).
1. F
  • Gene Name : F
  • Sequence Strain (Species/Organism) : Human metapneumovirus
  • NCBI Protein GI : AAU12148
  • Other Database IDs : CDD:278924
  • Taxonomy ID : 162145
  • Protein Name : F protein
  • Protein pI : 7.26
  • Protein Weight : 19607.66
  • Protein Length : 252
  • Protein Note : Fusion glycoprotein F0; pfam00523
  • Protein Sequence : Show Sequence
    >AAU12148.1 F protein, partial [Human metapneumovirus]
    YTYVFTLEVGDVENLTCTDGPSLIKTELDLTKSALRELKTVSADQLAREEQIENPRQSRFVLGAIALGVA
    TAAAVTAGIAIAKTIRLESEVNAIKGALKQTNEAVSTLGNGVRVLATAVRELKEFVSKNLTSAINRNKCD
    IADLKMAVSFSQFNRRFLNVVRQFSDNAGITPAISLDLMTDAELARAVSYMPT
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation :
2. G protein
  • Gene Name : G protein
  • Sequence Strain (Species/Organism) : Human metapneumovirus CAN97-83
  • NCBI Protein GI : 75549950
  • Other Database IDs : CDD:118131
  • Taxonomy ID : 694067
  • Gene Strand (Orientation) : ?
  • Protein Name : Major surface glycoprotein G
  • Protein Length : 219
  • Protein Note : Attachment glycoprotein G; Membrane-bound glycoprotein; mG
  • Protein Sequence : Show Sequence
    >gi|75549950|sp|Q6WB94.1|VGLG_HMPVC RecName: Full=Major surface glycoprotein G; AltName: Full=Attachment glycoprotein G; AltName: Full=Membrane-bound glycoprotein; Short=mG
    MEVKVENIRAIDMLKARVKNRVARSKCFKNASLILIGITTLSIALNIYLIINYTIQKTSSESEHHTSSPP
    TESNKEASTISTDNPDINPNSQHPTQQSTENPTLNPAASVSPSETEPASTPDTTNRLSSVDRSTAQPSES
    RTKTKPTVHTRNNPSTASSTQSPPRATTKAIRRATTFRMSSTGKRPTTTSVQSDSSTTTQNHEETGSANP
    QASVSTMQN
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A G mutant is attenuated in African green monkeys and induces protection from challenge with wild type HMPV (Biacchesi et al., 2005).
  • Related Vaccine(s): Human metapneumovirus G protein mutant vaccine
3. M
  • Gene Name : M
  • Sequence Strain (Species/Organism) : Human metapneumovirus
  • NCBI Protein GI : CAD28609
  • Other Database IDs : CDD:281396
    GOA:Q80IJ6
    InterPro: IPR005056
    UniProtKB/TrEMBL: Q80IJ6
  • Taxonomy ID : 162145
  • Protein Name : matrix
  • Protein pI : 4.56
  • Protein Weight : 9995.7
  • Protein Length : 150
  • Protein Note : Pneumovirus matrix protein; pfam03393
  • Protein Sequence : Show Sequence
    >CAD28609.1 matrix, partial [Human metapneumovirus]
    YQGIPYTAAVQVDLIEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQNGPILKVNASAQG
    AAMSVLPKKFEVNATVALDEYSKLE
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Aerts et al., 2015)
4. M2-2
  • Gene Name : M2-2
  • Sequence Strain (Species/Organism) : Human metapneumovirus CAN97-83
  • NCBI Protein GI : 75549952
  • Taxonomy ID : 694067
  • Gene Strand (Orientation) : ?
  • Protein Name : Matrix protein M2-2
  • Protein Length : 71
  • Protein Note : Matrix protein M2-2. /FTId=PRO_0000394813.
  • Protein Sequence : Show Sequence
    >gi|75549952|sp|Q6WB96.1|M22_HMPVC RecName: Full=Matrix protein M2-2
    MTLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYL
    S
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An M2-2 mutant is attenuated in African green monkeys and induced protection from challenge with wild type HMPV (Biacchesi et al., 2005).
  • Related Vaccine(s): Human metapneumovirus M2-2 mutant vaccine
5. P
  • Gene Name : P
  • Sequence Strain (Species/Organism) : Human metapneumovirus
  • NCBI Protein GI : YP_012606
  • Other Database IDs : CDD:280615
  • Taxonomy ID : 162145
  • Protein Name : phosphoprotein
  • Protein pI : 4.54
  • Protein Weight : 32449.44
  • Protein Length : 352
  • Protein Note : Pneumovirus phosphoprotein; pfam02478
  • Protein Sequence : Show Sequence
    >YP_012606.1 phosphoprotein [Human metapneumovirus]
    MSFPEGKDILFMGNEAAKLAEAFQKSLRKPSHKRSQSIIGEKVNTVSETLELPTISRPTKPTILSEPKLA
    WTDKGGAIKTEAKQTIKVMDPIEEEEFTEKRVLPSSDGKTPAEKKLKPSTNTKKKVSFTPNEPGKYTKLE
    KDALDLLSDNEEEDAESSILTFEERDTSSLSIEARLESIEEKLSMILGLLRTLNIATAGPTAARDGIRDA
    MIGIREELIADIIKEAKGKAAEMMEEEMNQRTKIGNGSVKLTEKAKELNKIVEDESTSGESEEEEELKDT
    QENNQEDDIYQLIM
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (O'Shaughnessy et al., 2011)
III. Vaccine Information
1. Human metapneumovirus G protein mutant vaccine
a. Vaccine Ontology ID:
VO_0002976
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
African green monkey
e. Gene Engineering of G protein
f. Immunization Route
intranasal immunization
g. Monkey Response
  • Persistence: A G protein mutant is attenuated in African green monkeys (Biacchesi et al., 2005).
  • Efficacy: A G protein mutant induces significant protection in African green monkeys from challenge with wild type HMPV (Biacchesi et al., 2005).
2. Human metapneumovirus M2-2 mutant vaccine
a. Vaccine Ontology ID:
VO_0002977
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
African green monkeys
e. Gene Engineering of M2-2
f. Immunization Route
intranasal immunization
g. Monkey Response
  • Persistence: An M2-2 mutant is attenuated in African green monkeys (Biacchesi et al., 2005).
  • Efficacy: An M2-2 mutant induces significant protection in African green monkeys from challenge with wild type HMPV (Biacchesi et al., 2005).
IV. References
1. Aerts et al., 2015: Aerts L, Rhéaume C, Carbonneau J, Lavigne S, Couture C, Hamelin MÈ, Boivin G. Adjuvant effect of the human metapneumovirus (HMPV) matrix protein in HMPV subunit vaccines. The Journal of general virology. 2015; 96(Pt 4); 767-774. [PubMed: 25519171].
2. Biacchesi et al., 2005: Biacchesi S, Pham QN, Skiadopoulos MH, Murphy BR, Collins PL, Buchholz UJ. Infection of nonhuman primates with recombinant human metapneumovirus lacking the SH, G, or M2-2 protein categorizes each as a nonessential accessory protein and identifies vaccine candidates. Journal of virology. 2005; 79(19); 12608-12613. [PubMed: 16160190].
3. Más et al., 2016: Más V, Rodriguez L, Olmedillas E, Cano O, Palomo C, Terrón MC, Luque D, Melero JA, McLellan JS. Engineering, Structure and Immunogenicity of the Human Metapneumovirus F Protein in the Postfusion Conformation. PLoS pathogens. 2016; 12(9); e1005859. [PubMed: 27611367].
4. O'Shaughnessy et al., 2011: O'Shaughnessy L, Carr M, Crowley B, Carberry S, Doyle S. Recombinant expression and immunological characterisation of proteins derived from human metapneumovirus. Journal of clinical virology : the official publication of the Pan American Society for Clinical Virology. 2011; 52(3); 236-243. [PubMed: 21920812].
5. Wiki: Metapneumovirus: Metapneumovirus [http://en.wikipedia.org/wiki/Metapneumovirus]