VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Simian Immunodeficiency Virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. Core protein (Other)
    2. env (Other)
    3. env HIV (Other)
    4. env receptor binding subunit (Other)
    5. gag (Other)
    6. gag-pol (Other)
    7. env (Protective antigen)
    8. nef (Virmugen)
  3. Vaccine Information
    1. rBCG-SIVgag
    2. rMVA-SIV-CD40L
    3. SabRV-SIV
    4. Simian Immunodeficiency Virus nef mutant vaccine
    5. SIV DNA vaccine pSIVgag and pmacIL-15 encoding SIV core protein
    6. SIV DNA vaccine pVacc4 encoding env from mac239
    7. SIV recombinant vector vaccine rAd5/rLCMV
  4. References
I. General Information
1. NCBI Taxonomy ID:
11723
2. Disease:
Simian AIDS
3. Introduction
Simian Immunodeficiency Virus is a retrovirus that can infect at least 33 species of African primates. It has been present in primates for at least 32,000 years. Infections in the natural hosts appear to be generally non-pathogenic, except in the case of the Asian rhesus macaque, which will develop SAIDS (Wiki: Simian immunodeficiency virus).
1. Core protein
  • Gene Name : Core protein
  • Sequence Strain (Species/Organism) : Simian immunodeficiency virus
  • NCBI Protein GI : 54312018
  • Other Database IDs : CDD:109591
    CDD:201337
    CDD:199156
  • Taxonomy ID : 11723
  • Gene Strand (Orientation) : ?
  • Protein Name : core protein
  • Protein Length : 510
  • Protein Note : gag gene protein p17 (matrix protein); pfam00540
  • Protein Sequence : Show Sequence
    >gi|54312018|dbj|BAD66663.1| core protein [Simian immunodeficiency virus]
    MGVRNSVLSGKKADELEKIRLRPNGKKKYMLKHVVWAANELDRFGLAESLLENKEGCQKILSVLAPLVPT
    GSENLKSLYNTVCVIWCIHAEEKVKHTEEAKQIVQRHLVVETGTTETMPKTSRPTAPSSGRGGNYPVQQI
    GGNYVHLPLSPRTLNAWVKLIEEKKFGAEVVPGFQALSEGCTPYDINQMLNCVGDHQAAMQIIRDIINEE
    AADWDLQHPQPAPQQGQLREPSGSDIAGTTSSVDEQIQWMYRQQNPIPVGNIYRRWIQLGLQKCVRMYNP
    TNILDVKQGPKEPFQSYVDRFYKSLRAEQTDAAVKNWMTQTLLIQNANPDCKLVLKGLGVNPTLEEMLTA
    CQGVGGPGQKARLMAEALKEALAPVPIPFAAAQQRGPRKPIKCWNCGKEGHSARQCRAPRRQGCWKCGKM
    DHVMAKCPDRQAGFLGLGPWGKKPRNFPMAQVHQGLMPTAPPEDPAVDLLKNYMQLGKQQREKQRESREK
    PYKEVTEDLLHLNSLFGGDQ
  • Molecule Role : Other
  • Related Vaccine(s): SIV DNA vaccine pSIVgag and pmacIL-15 encoding SIV core protein
2. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Simian immunodeficiency virus
  • NCBI Protein GI : 532231
  • Other Database IDs : CDD:109567
    CDD:197369
  • Taxonomy ID : 11723
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein
  • Protein Length : 881
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >gi|532231|gb|AAB00470.1| envelope glycoprotein [Simian immunodeficiency virus]
    MGCLGNQLLIAILLLSVYGIYCTQYVTVFYGVPAWRNATIPLFCATKNRDTWGTTQCLPDNGDYSELALN
    VTESFDAWNNTVTEQAIEDVWQLFETSIRPCVKLSPLCITMRCNKSETDKWGLTKSSTTTASTTTTTPTT
    ASKIDMVNETSSCITHDNCTGLEQEQMISCKFNMTGLKRDKKKEYNETWYSTDLVCEQGNSTDNESRCYM
    NHCNTSVIQESCDKHYWDTIRFRYCAPPGYALLRCNDTNYSGFMPKCSKVVVSSCTRMMETQTSTWFGFN
    GTRAENRTYIYWHGRDNRTIISLSKYYNLTMKCRRPGNKTVLPVTIMSGLVFHSQPINDRPKQAWCWFGG
    EWKDAIKEVKQTIVKHPRYTGTNNTDKINLTAPGGGDPEVTFMWTNCRGEFLYCKMNWFLNWVEDRNTTN
    QKPNEQHKRNYVPCHIRQIINTWHKVGKNVYLPPREGDLTCNSTVTSLIANIDWTDGNQTNITMSAEVAE
    LYRLELGDYKLVEITPIGLAPTNVKRYTTGGTSRNKRGVFVLGFLGFLATAGSAMGAASLTLTAQSRTLL
    AGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGCAFRQVCHTTVPWPNASL
    TPDWNNDTWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNSWDVFGNWFDLASWIKYIQYGIYMV
    VGVILLRIVIYIVQMLAKLRQGYRPVFSSPPSYFQQTHIQQDPALPTREGKEGDGGEGGGNSSWPWQIEY
    IHFLIRQLIRLLTWLFSNCRTLLSRAYQILQPIFQRLSATLQRIREVLRTELTYLQYGWSYFQEAVQVGW
    RSATETLAGAWGDLWETLRRGGRWILAIPRRIRQGLELTLL
  • Molecule Role : Other
  • Related Vaccine(s): SabRV-SIV , SIV DNA vaccine pVacc4 encoding env from mac239
3. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Simian-Human immunodeficiency virus
  • NCBI Protein GI : 343533448
  • Other Database IDs : CDD:109567
    CDD:197369
  • Taxonomy ID : 57667
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein
  • Protein Length : 853
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >gi|343533448|gb|AEM54739.1| envelope glycoprotein [Simian-Human immunodeficiency virus]
    MKVKGIRKNYQHLWKWGIMFLGMLMICSAVENLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWAT
    HACVPTDPNPQEILLENVTEDFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTDLRNVTNIN
    NSSEGMRGEMKNCSFNITTSIRDKVKKEYALFYRLDVVPIDNDNTSYRLISCNTSTITQACPKVSFEPIP
    IHYCTPAGFAILKCKDKKFNGTGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSSNFTDNAKNI
    IVQLNETVEINCTRPNNNTRKRITLGPGRVVYTTGEIVGDIRKAHCNISKVKWHNTLKRVAEKLREKFEN
    KTIVFNKSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWKFNDTWNLTQVSGTEGNDIITLPCRIKQIIN
    MWQKVGKAMYAPPIRGQIRCSSNITGLILTRDGGNNHNNDTEIFRPGGGDMRDNWRSELYKYKVVRIEPL
    GVAPTKAKRRVVQREKRAVGTIGAVFLGFLGAAGSTMGAASITLTVQARLLLSGIVQQQNNLLRAIEAQQ
    HLLQLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICTTAVPWNASWSNKTLDMIWNNMTWMEWER
    EIDNYTGLIYNLIEESQNQQEKNEQELLALDKWAGLWNWFDISNWLWYIKIFIMIVGGLIGLRIVFSVLS
    IVNRVRQGYSPLSFQTRSPASRGPDRPEGIEEEGGDRDRDRSVRLVDGFLALIWDDLRSLCLFSYRRLRD
    LLLIATRIVELLGRRGRELLRYWWNLLQYWSQELKNSAVSLLNATAIAVGEGTDRIVEILQRAGRAILHI
    PTRIRQGLERTLL
  • Molecule Role : Protective antigen
4. env HIV
  • Gene Name : env HIV
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Gene ID : 155971
  • NCBI Protein GI : 9629363
  • Locus Tag : HIV1gp8
  • Genbank Accession : AF033819
  • Protein Accession : NP_057856
  • Taxonomy ID : 11676
  • Gene Starting Position : 5770
  • Gene Ending Position : 8340
  • Gene Strand (Orientation) : +
  • Protein Name : Envelope surface glycoprotein gp160, precursor
  • Protein pI : 9.19
  • Protein Weight : 91753.45
  • Protein Length : 856
  • DNA Sequence : Show Sequence
    >gi|9629357:5770-8340 Human immunodeficiency virus 1, complete genome
    AATGAGAGTGAAGGAGAAATATCAGCACTTGTGGAGATGGGGGTGGAGATGGGGCACCATGCTCCTTGGG
    ATGTTGATGATCTGTAGTGCTACAGAAAAATTGTGGGTCACAGTCTATTATGGGGTACCTGTGTGGAAGG
    AAGCAACCACCACTCTATTTTGTGCATCAGATGCTAAAGCATATGATACAGAGGTACATAATGTTTGGGC
    CACACATGCCTGTGTACCCACAGACCCCAACCCACAAGAAGTAGTATTGGTAAATGTGACAGAAAATTTT
    AACATGTGGAAAAATGACATGGTAGAACAGATGCATGAGGATATAATCAGTTTATGGGATCAAAGCCTAA
    AGCCATGTGTAAAATTAACCCCACTCTGTGTTAGTTTAAAGTGCACTGATTTGAAGAATGATACTAATAC
    CAATAGTAGTAGCGGGAGAATGATAATGGAGAAAGGAGAGATAAAAAACTGCTCTTTCAATATCAGCACA
    AGCATAAGAGGTAAGGTGCAGAAAGAATATGCATTTTTTTATAAACTTGATATAATACCAATAGATAATG
    ATACTACCAGCTATAAGTTGACAAGTTGTAACACCTCAGTCATTACACAGGCCTGTCCAAAGGTATCCTT
    TGAGCCAATTCCCATACATTATTGTGCCCCGGCTGGTTTTGCGATTCTAAAATGTAATAATAAGACGTTC
    AATGGAACAGGACCATGTACAAATGTCAGCACAGTACAATGTACACATGGAATTAGGCCAGTAGTATCAA
    CTCAACTGCTGTTAAATGGCAGTCTAGCAGAAGAAGAGGTAGTAATTAGATCTGTCAATTTCACGGACAA
    TGCTAAAACCATAATAGTACAGCTGAACACATCTGTAGAAATTAATTGTACAAGACCCAACAACAATACA
    AGAAAAAGAATCCGTATCCAGAGAGGACCAGGGAGAGCATTTGTTACAATAGGAAAAATAGGAAATATGA
    GACAAGCACATTGTAACATTAGTAGAGCAAAATGGAATAACACTTTAAAACAGATAGCTAGCAAATTAAG
    AGAACAATTTGGAAATAATAAAACAATAATCTTTAAGCAATCCTCAGGAGGGGACCCAGAAATTGTAACG
    CACAGTTTTAATTGTGGAGGGGAATTTTTCTACTGTAATTCAACACAACTGTTTAATAGTACTTGGTTTA
    ATAGTACTTGGAGTACTGAAGGGTCAAATAACACTGAAGGAAGTGACACAATCACCCTCCCATGCAGAAT
    AAAACAAATTATAAACATGTGGCAGAAAGTAGGAAAAGCAATGTATGCCCCTCCCATCAGTGGACAAATT
    AGATGTTCATCAAATATTACAGGGCTGCTATTAACAAGAGATGGTGGTAATAGCAACAATGAGTCCGAGA
    TCTTCAGACCTGGAGGAGGAGATATGAGGGACAATTGGAGAAGTGAATTATATAAATATAAAGTAGTAAA
    AATTGAACCATTAGGAGTAGCACCCACCAAGGCAAAGAGAAGAGTGGTGCAGAGAGAAAAAAGAGCAGTG
    GGAATAGGAGCTTTGTTCCTTGGGTTCTTGGGAGCAGCAGGAAGCACTATGGGCGCAGCCTCAATGACGC
    TGACGGTACAGGCCAGACAATTATTGTCTGGTATAGTGCAGCAGCAGAACAATTTGCTGAGGGCTATTGA
    GGCGCAACAGCATCTGTTGCAACTCACAGTCTGGGGCATCAAGCAGCTCCAGGCAAGAATCCTGGCTGTG
    GAAAGATACCTAAAGGATCAACAGCTCCTGGGGATTTGGGGTTGCTCTGGAAAACTCATTTGCACCACTG
    CTGTGCCTTGGAATGCTAGTTGGAGTAATAAATCTCTGGAACAGATTTGGAATCACACGACCTGGATGGA
    GTGGGACAGAGAAATTAACAATTACACAAGCTTAATACACTCCTTAATTGAAGAATCGCAAAACCAGCAA
    GAAAAGAATGAACAAGAATTATTGGAATTAGATAAATGGGCAAGTTTGTGGAATTGGTTTAACATAACAA
    ATTGGCTGTGGTATATAAAATTATTCATAATGATAGTAGGAGGCTTGGTAGGTTTAAGAATAGTTTTTGC
    TGTACTTTCTATAGTGAATAGAGTTAGGCAGGGATATTCACCATTATCGTTTCAGACCCACCTCCCAACC
    CCGAGGGGACCCGACAGGCCCGAAGGAATAGAAGAAGAAGGTGGAGAGAGAGACAGAGACAGATCCATTC
    GATTAGTGAACGGATCCTTGGCACTTATCTGGGACGATCTGCGGAGCCTGTGCCTCTTCAGCTACCACCG
    CTTGAGAGACTTACTCTTGATTGTAACGAGGATTGTGGAACTTCTGGGACGCAGGGGGTGGGAAGCCCTC
    AAATATTGGTGGAATCTCCTACAGTATTGGAGTCAGGAACTAAAGAATAGTGCTGTTAGCTTGCTCAATG
    CCACAGCCATAGCAGTAGCTGAGGGGACAGATAGGGTTATAGAAGTAGTACAAGGAGCTTGTAGAGCTAT
    TCGCCACATACCTAGAAGAATAAGACAGGGCTTGGAAAGGATTTTGCTATA
  • Protein Sequence : Show Sequence
    >gi|9629363|ref|NP_057856.1| Envelope surface glycoprotein gp160, precursor [Human immunodeficiency virus 1]
    MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWA
    THACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNT
    NSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSF
    EPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDN
    AKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLR
    EQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRI
    KQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVK
    IEPLGVAPTKAKRRVVQREKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIE
    AQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNHTTWME
    WDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFA
    VLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHR
    LRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRAI
    RHIPRRIRQGLERILL
  • Molecule Role : Other
5. env receptor binding subunit
  • Gene Name : env receptor binding subunit
  • Sequence Strain (Species/Organism) : Simian immunodeficiency virus
  • NCBI Protein GI : 603752
  • Other Database IDs : CDD:109567
  • Taxonomy ID : 11723
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein gp120 receptor binding subunit
  • Protein Length : 527
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >gi|603752|gb|AAA57442.1| envelope glycoprotein gp120 receptor binding subunit, partial [Simian immunodeficiency virus]
    MGCLGNQLLIAILLLSVYGIYCTLYVTVFYGVPAWRNATIPLFCATKNRDTWGTTQCLPDNGDYSEMALN
    VTESFDAWNNTVTEQAIEDVWQLFETSIKPCVRLSPLCITMRCNKSETDRWGLTKSITTTAPTASTTASA
    EVDMVNETSSCIAQDNCTGLEQEQMISCKFNMTGLKRNKKKEYNETWYSADLVCEQGNNTGNESRCYMNH
    CNTSVIQESCDKHYWDAIRFRYCAPPGYALLRCNDTNYSGFMPKCSKVVVSSCTRMMETQTSTWFGFNGT
    RAENRTYIYWHGRNNRTIISLNKYYNLTMKCRRPGNKTVLPVTIMSGLVFHSQPINGRPKQAWCWFEGKW
    KDAIKEVKQTIVKHPRYTGTNNTDKINLTAPRGGNPEVTFMWTNCRGEFLYCKMNWFLNWVEDRNTANQK
    PNEQHKRNYVPCHIRQIINTWHKVGKNVYLPPREGDLTCNSTVTSLIANIDWIDGNQTNISMSAEVAELY
    RLELGDYKLVEITPIGLAPTSVKRYTTGGTSRNKRGV
  • Molecule Role : Other
  • Related Vaccine(s): SabRV-SIV
6. gag
  • Gene Name : gag
  • Sequence Strain (Species/Organism) : Simian immunodeficiency virus SIV-mnd 2
  • NCBI Gene ID : 956108
  • NCBI Protein GI : 27311167
  • Locus Tag : Siv2gp1
  • Genbank Accession : AF367411
  • Protein Accession : NP_758886
  • Taxonomy ID : 159122
  • Gene Starting Position : 736
  • Gene Ending Position : 2289
  • Gene Strand (Orientation) : +
  • Protein Name : gag protein
  • Protein pI : 8.78
  • Protein Weight : 55072.29
  • Protein Length : 517
  • DNA Sequence : Show Sequence
    >gi|27311166:736-2289 Simian immunodeficiency virus SIV-mnd 2, complete genome
    AATGGGCGCGAGCGCGTCAGGTCTTAGGGGAGAAAAATTGGACGAGCTGGAAAAGATTAGGTTACGGCCC
    TCCGGAAAAAAGAAATACCAGCTGAAACACATAATATGGGTAAGCAAGGAACTAGACAGATTTGGCCTTC
    ATGAAAAGCTGTTAGAAAGTAAGGAAGGATGCGAGAAAATTCTTAGCGTACTCTTTCCACTAGTTCCTAC
    AGGGTCAGAAAATTTAATCTCGCTGTACAACACCTGCTGCTGCGTATGGTGCGTACATGCGAAAGAGAAA
    GTAACAGATACAGAGGAAGCGAAAGAGAAAGTAAAACAAAAGCTCCATCTAGTGGCCGAAAAGGAAAATG
    CAGCATCAGAAAAAGAACAAAGAGCAATAGTGACACCTAGTGGCCGCTCAAAAAATTACCCAATACAGAT
    AATAAATCAGACCCCAGTCCATCAGGGAATTTCACCGCGCACGCTGAATGCGTGGGTAAAATGCATAGAA
    GAGAAGAAGTTTAGCCCAGAAATAGTGCCCATGTTCATAGCCTTGTCTGAAGGGTGCCTCCCCTATGATC
    TCAATGGCATGCTCAATGCTATTGGAGACCATCAGGGAGCGCTTCAAATAGTGAAGGATGTCATCAATGA
    GGAAGCTGCAGACTGGAACTTGAGACACCCACAAGTGGGTCCTATGCCCCAAGGTGTCTTGAGAAACCCA
    ACGGGCAGTGATATTGCTGGAACAACAAGCTCCATAGAAGAGCAGATAGAATGGACTACAAGGGAGCAAG
    ATGCAGTAAATGTGGGAGGAATATATAAACAATGGATAGTTTTAGGGCTTCAGAAGTGTGTAAGCATGTA
    TAATCCAGTAAACATCCTGGACATAAAGCAAGGACCAAAGGAGCCGTTCAAGGACTATGTGGACAGGTTT
    TACAAAGCTCTGCGGGCGGAGCGGACTGATCCACAAGTCAAAACCTGGATGACACAAACTTTGCTCATCC
    AGAATGCTAACCCAGATTGTAAATCCATCCTTAAAGGGCTAGGCATGAATCCCTCTTTAGAAGAGATGCC
    GCTAGCCTGCCAAGGGGTAGGAGGCCCTAAATATAAAGCACAAATGATGGCAGAGGCTATGAAGGAAGCC
    CAGTCAGCTGTAATGATGCAGAATTCGGGAGGGCCACCGCGGGGCCCCCCGAGACAACCTCCTAGAAACA
    TCAGATGCCCTAACTGTGGAAAATTTGGTCATGGGCTGAGGGACTGTATAAGCCCTCGAAAAAAGGGATG
    CTTCAAGTGTGGAGATCTAGGACACATAATGAGAAATTGCCCAAAGATGGTGAATTTTTTAGGGAATACC
    CCCTGGGGCAGTGGCAAACCCAGGAACTTCCCGGCGATGCCATTGACCCCAACGGCCCCTCCAATGCCAG
    GGATGGAAGACCCAGCAGAGAGAATGCTGTTAGATTACATGAAGAAAGGGCAACAGCAGAAAGCGGAAAG
    CAAACAGGAAAAGAAAGAGAGGGGTCCATACGAGGCAGCTTACAACTCCCTCAGTTCTCTCTTTGGAACA
    GACCAACTACAGTA
  • Protein Sequence : Show Sequence
    >gi|27311167|ref|NP_758886.1| gag protein [Simian immunodeficiency virus SIV-mnd 2]
    MGASASGLRGEKLDELEKIRLRPSGKKKYQLKHIIWVSKELDRFGLHEKLLESKEGCEKILSVLFPLVPT
    GSENLISLYNTCCCVWCVHAKEKVTDTEEAKEKVKQKLHLVAEKENAASEKEQRAIVTPSGRSKNYPIQI
    INQTPVHQGISPRTLNAWVKCIEEKKFSPEIVPMFIALSEGCLPYDLNGMLNAIGDHQGALQIVKDVINE
    EAADWNLRHPQVGPMPQGVLRNPTGSDIAGTTSSIEEQIEWTTREQDAVNVGGIYKQWIVLGLQKCVSMY
    NPVNILDIKQGPKEPFKDYVDRFYKALRAERTDPQVKTWMTQTLLIQNANPDCKSILKGLGMNPSLEEMP
    LACQGVGGPKYKAQMMAEAMKEAQSAVMMQNSGGPPRGPPRQPPRNIRCPNCGKFGHGLRDCISPRKKGC
    FKCGDLGHIMRNCPKMVNFLGNTPWGSGKPRNFPAMPLTPTAPPMPGMEDPAERMLLDYMKKGQQQKAES
    KQEKKERGPYEAAYNSLSSLFGTDQLQ
  • Molecule Role : Other
  • Related Vaccine(s): rBCG-SIVgag
7. gag-pol
  • Gene Name : gag-pol
  • Sequence Strain (Species/Organism) : Simian immunodeficiency virus
  • NCBI Gene ID : 1490009
  • NCBI Protein GI : 22535297
  • Locus Tag : SIVgp1
  • Genbank Accession : M66437
  • Protein Accession : NP_687035
  • Taxonomy ID : 11723
  • Gene Starting Position : 896
  • Gene Ending Position : 5313
  • Gene Strand (Orientation) : +
  • Protein Name : Gag-Pol
  • Protein pI : 8.66
  • Protein Weight : 157171.22
  • Protein Length : 1472
  • DNA Sequence : Show Sequence
    >gi|9627204:896-5313 Simian immunodeficiency virus, complete genome
    AATGGGCGGGGGTCACTCAGCACTGTCAGGGAGAAGCCTCGACACGTTCGAGAAGATTAGGCTACGTCCG
    AACGGGAAAAAGAAGTACCAAATTAAACATTTAATATGGGCAGGAAAAGAAATGGAACGATTTGGGTTAC
    ATGAGAAACTTTTAGAAACAAAAGAAGGCTGTCAAAAAATCATAGAAGTTTTAACCCCGTTGGAACCGAC
    AGGCTCCGAGGGGCTAAAAGCTCTGTTTAATTTGTGCTGCGTCATTTGGTGCATTCACGCAGAACAGAAA
    GTGAAAGACACAGAGGAAGCTGTAGTAACAGTTAAGCAACACTACCATCTAGTGGACAAAAATGAGAAAG
    CAGCTAAAAAGAAAAATGAGACAACAGCGCCACCTGGTGGCGAATCAAGAAATTACCCAGTAGTAAATCA
    GAATAATGCCTGGGTACACCAGCCTTTGTCTCCGCGCACGTTAAATGCGTGGGTCAAATGCGTGGAGGAA
    AAAAGGTGGGGAGCAGAAGTAGTCCCCATGTTCCAAGCACTCTCAGAGGGATGTCTCTCCTATGATGTAA
    ATCAGATGCTCAATGTAATAGGAGACCATCAGGGGGCATTACAAATTCTTAAGGAAGTCATTAATGAAGA
    AGCAGCAGAGTGGGACAGGACACACAGACCACCAGCTGGCCCGTTACCAGCAGGGCAGCTAAGAGACCCG
    ACAGGGTCAGATATAGCAGGAACTACCAGCTCAATTCAGGAACAAATAGAGTGGACCTTCAATGCCAATC
    CAAGAATAGACGTAGGGGCACAATACAGAAAATGGGTTATTTTGGGCTTACAAAAGGTAGTGCAGATGTA
    CAATCCCCAAAAGGTCCTAGACATTCGACAGGGACCTAAAGAACCCTTCCAGGACTATGTAGACAGATTC
    TATAAAGCCCTGAGAGCAGAACAAGCACCACAGGATGTTAAAAATTGGATGACACAAACTTTGCTTATCC
    AGAATGCCAATCCGGATTGTAAATTGATTCTGAAAGGATTGGGAATGAATCCAACCTTGGAGGAAATGCT
    AATAGCTTGCCAGGGAGTAGGAGGGCCACAACATAAGGCTAAGCTAATGGTAGAAATGATGAGTAATGGA
    CAGAATATGGTCCAAGTGGGACCTCAGAAAAAGGGCCCCCGAGGGCCGCTAAAATGCTTTAATTGTGGCA
    AATTTGGACATATGCAAAGGGAATGCAAGGCACCAAGACAGATCAAATGCTTTAAGTGCGGCAAAATTGG
    CCATATGGCAAAAGACTGCAAGAATGGACAGGCAAATTTTTTAGGGTATGGCCATTGGGGAGGAGCGAAA
    CCAAGAAATTTTGTGCAATACAGAGGAGACACAGTTGGTCTGGAACCAACAGCCCCCCCAATGGAAACAG
    CTTACGATCCAGCAAAGAAGCTCCTCCAGCAGTATGCAGAGAAGGGACAGCGCCTGAGAGAGGAGAGAGA
    ACAGACAAGGAAACAGAAGGAGAAAGAAGTGGAGGATGTTTCCTTGAGCTCCCTCTTTGGAGGAGACCAA
    TGAAACGAGTCATCATAGAAGGAACGCCAGTGCAAGCCTTGTTAGATACAGGAGCAGATGACACTATAAT
    TCAAGAAAAGGACTTGCACTTTCCCCCACATAAACCATGGCGTTCCAAGGTAGTAGGAGGTATAGGAGGA
    GGGATTCATGTCAAAGAATATCAGGGGGTACAAGTACAATTGGAGGATAAAATCATCACCGGCTCAATTC
    TAATAGGAAGTACACCAATCAATATTATAGGAAGAAATATTTTAGCTCAGGCAGGCATGAAATTAGTTAT
    GGGAGTTCTATCTAGTCAGATTGAGGAAACAAAAGTACAACTAAAAGAAGGGAAAGATGGACCTAAATTG
    AAACAATGGCCCTTATCAAGAGAAAAAATTGAAGCTTTAACAGAAATATGCAAACAAATGGAAGAGGAGG
    GAAAATTATCTAGGATAGGAGGAGAAAATCCTTATAATACACCAGTGTTTGCCATAAAGAAAAAGGATAA
    AACACAATGGAGAATGCTTGTAGATTTCAGGGAACTAAACAAAGCTACTCAAGACTTTTTTGAGGTTCAG
    CTGGGAATTCCTCACCCAGCGGGCCTTCAGAAAAAGAAGCAAATCACAGTAATAGACATAGGGGATGCCT
    ATTATTCAATACCATTATGCAAGGAATTCAGAAAATATACAGCATTTACCATCCCCTCAGTAAATAATAC
    AGGGCCAGGGATAAGGTATCAGTTCAATTGTCTGCCTCAGGGATGGAAAGGATCTCCTACAATTTTCCAG
    AATACGGCAGCAAACATTTTAGAGGAGATCAAAAGGCACACTCCTGGGTTAGAAATTGTCCAATACATGG
    ACGATTTGTGGTTGGCGTCAGACCATGATGAGACTAGACATAATCAACAGGTAGACATAGTAAGAAAGAT
    GCTGCTAGAAAAAGGTCTAGAAACCCCAGACAAGAAAGTCCAAAGAGAACCGCCATGGGAATGGATGGGG
    TATAAATTGCATCCGAATAAATGGACCATTAACAAAATAGAATTACCCCCCTTAGAAGGAGAATGGACAG
    TAAACAAAATACAGAAGGTAGTAGGAGTTCTAAATTGGGCAAGTCAAATTTATCCAGGAATTAAAACCAA
    ACATACCTGTGCCATGTTGAGAGGGAAAAAGAACCTCCTAGAAGAAATAGTATGGACAGAAGAGGCAGAG
    GCAGAATATAAGAACAATCAAGGGATAGTGCAGGAAACACAAGAAGGAACATACTATGACCCTCTCAAAG
    AATTAATAGCAACAGTTCAAAAGCAAGGAGAAGGGCAATGGACATACCAATTCACCCAAGAAGGGGCAGT
    ATTAAAGGTGGGAAGATATGCCAAGCAAAGAGAAACTCATACTAATGATCTAAGGACTCTAGCACACCTT
    GTCCAAAAAATCTGTAAGGAAGCACTTACCATTTGGGGAAGACTTCCACGAGTACAACTCCCAGTAGACA
    AGAAAACATGGGATATGTGGTGGCAGGACTATTGGCAAGTATCCTGGATACCAGAATGGGAGTTTGTTAG
    CACACCACTCCTAGTAAAACTGTGGTATTCCTTAGTAAAAGAACCAATCAAAGGAGAAGATGTTTATTAT
    GTGGATGGGGCAGCATCCAAAGTGACCAAATTAGGTAAGGCAGGATATCTGTCAGAGAGAGGAAAAAGTA
    GAATTAGGGAATTAGAAAACACCACTAACCAACAAGCAGAATTAACAGCAGTTAAGATGGCATTGGAGGA
    CAGTGGAGAAAATGTAAATATAGTCACAGATTCTCAATATGTAATGAACATCTTGACAGCATGTCCACAG
    GAAAGTAACTCACCCTTAGTGGAACAGATAATACAAGCCCTAATGAAAAAGAGGCAGGTCTACTTACAAT
    GGGTACCAGCTCATAAGGGGATAGGAGGCAATACAGAAATAGATAAATTAGTAAGCAAAGGAATAAGACA
    GATCCTCTTCTTAGATAGAATAGAAGAAGCACAAGATGACCATGCAAAGTACCATAACAATTGGAGAAGT
    ATGGTACAGGAATTTGGATTACCTAATATAGTAGCAAAAGAGATAGTAGCGGCATGTCCCAAATGCCAAA
    TAAGAGGAGAACCTAAGCATGGACAGGTAGACGCCTCCATTGAAACTTGGCAGATGGACTGCACCCATTT
    AGAAGGAAAAGTTATAATAGTAGCAGTACATGTAGCCAGTGGATTCATAGAAGCAGAGGTGATCCCAAGA
    GAAACTGGGAAGGAGACAGCACACTTTCTGCTGAAACTGTTAGCAAGATGGCCAGTGAAACATCTACACA
    CTGATAATGGCCCAAACTTTACCTCTCAGAATGTGGCAGCGGTGTGCTGGTGGGGTAATATAGAGCACAC
    CACTGGAATACCTTATAACCCACAGTCACAGGGTAGTGTAGAAAGCATGAACAGACAGCTCAAGGAAATC
    ATCTCTCAAATAAGAGATGATTGTGAGAGATTGGAGACAGCAGTGCAAATGGCTACGCATATCCACAATT
    TTAAAAGAAAGGGAGGAATAGGGGGTATCTCTAGTGCAGAAAGATTGGTTAATATGCTAACAACACAACT
    AGAACTAAATACTCTACAAAACCAAATCCAAAAAATTTTGAATTTTAAGGTCTACTACAGAGAAGGTAGA
    GATCCAGTGTGGAAAGGACCAGCGCGACTCATCTGGAAAGGAGAAGGCGCGGTGGTAATTAAAGAGGGGG
    AAGACATCAAGGTAGTCCCCAGGAGAAAGGCTAAGATTATCAAAGATTATGGAGAGAGAAAAACAATGGA
    TAGTGAGGGTAGTATGGAGGGTGTCAGAGAGGCAAATAAGCAGATGGAGGGGGATAGTGACTTACAAGAT
    CAGGAATA
  • Protein Sequence : Show Sequence
    >gi|22535297|ref|NP_687035.1| Gag-Pol [Simian immunodeficiency virus]
    MGGGHSALSGRSLDTFEKIRLRPNGKKKYQIKHLIWAGKEMERFGLHEKLLETKEGCQKIIEVLTPLEPT
    GSEGLKALFNLCCVIWCIHAEQKVKDTEEAVVTVKQHYHLVDKNEKAAKKKNETTAPPGGESRNYPVVNQ
    NNAWVHQPLSPRTLNAWVKCVEEKRWGAEVVPMFQALSEGCLSYDVNQMLNVIGDHQGALQILKEVINEE
    AAEWDRTHRPPAGPLPAGQLRDPTGSDIAGTTSSIQEQIEWTFNANPRIDVGAQYRKWVILGLQKVVQMY
    NPQKVLDIRQGPKEPFQDYVDRFYKALRAEQAPQDVKNWMTQTLLIQNANPDCKLILKGLGMNPTLEEML
    IACQGVGGPQHKAKLMVEMMSNGQNMVQVGPQKKGPRGPLKCFNCGKFGHMQRECKAPRQIKCFKCGKIG
    HMAKDCKNGQANFFRVWPLGRSETKKFCAIQRRHSWSGTNSPPNGNSLRSSKEAPPAVCREGTAPERGER
    TDKETEGERSGGCFLELPLWRRPMKRVIIEGTPVQALLDTGADDTIIQEKDLHFPPHKPWRSKVVGGIGG
    GIHVKEYQGVQVQLEDKIITGSILIGSTPINIIGRNILAQAGMKLVMGVLSSQIEETKVQLKEGKDGPKL
    KQWPLSREKIEALTEICKQMEEEGKLSRIGGENPYNTPVFAIKKKDKTQWRMLVDFRELNKATQDFFEVQ
    LGIPHPAGLQKKKQITVIDIGDAYYSIPLCKEFRKYTAFTIPSVNNTGPGIRYQFNCLPQGWKGSPTIFQ
    NTAANILEEIKRHTPGLEIVQYMDDLWLASDHDETRHNQQVDIVRKMLLEKGLETPDKKVQREPPWEWMG
    YKLHPNKWTINKIELPPLEGEWTVNKIQKVVGVLNWASQIYPGIKTKHTCAMLRGKKNLLEEIVWTEEAE
    AEYKNNQGIVQETQEGTYYDPLKELIATVQKQGEGQWTYQFTQEGAVLKVGRYAKQRETHTNDLRTLAHL
    VQKICKEALTIWGRLPRVQLPVDKKTWDMWWQDYWQVSWIPEWEFVSTPLLVKLWYSLVKEPIKGEDVYY
    VDGAASKVTKLGKAGYLSERGKSRIRELENTTNQQAELTAVKMALEDSGENVNIVTDSQYVMNILTACPQ
    ESNSPLVEQIIQALMKKRQVYLQWVPAHKGIGGNTEIDKLVSKGIRQILFLDRIEEAQDDHAKYHNNWRS
    MVQEFGLPNIVAKEIVAACPKCQIRGEPKHGQVDASIETWQMDCTHLEGKVIIVAVHVASGFIEAEVIPR
    ETGKETAHFLLKLLARWPVKHLHTDNGPNFTSQNVAAVCWWGNIEHTTGIPYNPQSQGSVESMNRQLKEI
    ISQIRDDCERLETAVQMATHIHNFKRKGGIGGISSAERLVNMLTTQLELNTLQNQIQKILNFKVYYREGR
    DPVWKGPARLIWKGEGAVVIKEGEDIKVVPRRKAKIIKDYGERKTMDSEGSMEGVREANKQMEGDSDLQD
    QE
  • Molecule Role : Other
  • Related Vaccine(s): SabRV-SIV
8. nef
  • Gene Name : nef
  • Sequence Strain (Species/Organism) : Simian immunodeficiency virus
  • NCBI Gene ID : 1490008
  • NCBI Protein GI : 9627209
  • Locus Tag : SIVgp7
  • Genbank Accession : M66437
  • Protein Accession : NP_054373
  • 3D structure: PDB ID : 3IOZ
  • Taxonomy ID : 11723
  • Gene Starting Position : 8599
  • Gene Ending Position : 9270
  • Gene Strand (Orientation) : ?
  • Protein Name : nef protein
  • Protein pI : 6.4
  • Protein Weight : 24504.09
  • Protein Length : 223
  • DNA Sequence : Show Sequence
    >gi|9627204:8599-9270 Simian immunodeficiency virus, complete genome
    TATGGGCTCCAGCAACTCCAAGAGGCAGCAACAGGGCTTGCTCAAGCTCTGGCGAGGGCTGCGAGGGAAG
    CCTGGGGCAGACTGGGTGCTATTGTCCGATCCGCTTATCGGGCAGTCATCAACAGTCCAAGAAGAGTGCG
    GCAAGGCCTTGAAAAAGTCCTGGGGTAAAGGTAAAATGACTCCAGACGGCCGCCGCCTGCAAGAAGGAGA
    CACCTTTGATGAGTGGGATGATGATGAAGAAGAAGTAGGCTTCCCTGTGCAACCTCGAGTCCCCTTAAGA
    CAGATGACCTATAAATTAGCAGTGGACTTTTCCCACTTTTTAAAATCAAAGGGGGGACTGGATGGGATAT
    ATTACTCTGAAAGAAGAGAAAAGATCCTGAATTTGTATGCCTTGAACGAGTGGGGAATAATAGATGATTG
    GCAAGCTTACTCACCAGGCCCGGGGATAAGGTACCCGAGAGTCTTTGGCTTCTGCTTTAAGCTAGTCCCA
    GTGGACCTGCATGAGGAGGCACGCAACTGTGAGAGACACTGTCTGATGCATCCAGCACAGATGGGGGAAG
    ATCCTGATGGAATAGATCATGGAGAAGTCTTGGTCTGGAAGTTTGACCCGAAGTTGGCGGTGGAGTACCG
    CCCGGACATGTTTAAGGACATGCACGAACATGCAAAGCGCTA
  • Protein Sequence : Show Sequence
    >gi|9627209|ref|NP_054373.1| nef protein [Simian immunodeficiency virus]
    MGSSNSKRQQQGLLKLWRGLRGKPGADWVLLSDPLIGQSSTVQEECGKALKKSWGKGKMTPDGRRLQEGD
    TFDEWDDDEEEVGFPVQPRVPLRQMTYKLAVDFSHFLKSKGGLDGIYYSERREKILNLYALNEWGIIDDW
    QAYSPGPGIRYPRVFGFCFKLVPVDLHEEARNCERHCLMHPAQMGEDPDGIDHGEVLVWKFDPKLAVEYR
    PDMFKDMHEHAKR
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A SIV nef mutant is attenuated in rhesus monkeys and induces protection from challenge with wild type SIV (Daniel et al., 1992).
  • Related Vaccine(s): Simian Immunodeficiency Virus nef mutant vaccine
III. Vaccine Information
1. rBCG-SIVgag
a. Vaccine Ontology ID:
VO_0004789
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Macaque
e. Antigen
M. bovis BCG-SIV Gag followed by boosting with rDIsSIVgag (Ami et al., 2005).
f. Gene Engineering of gag
  • Type: Recombinant vector construction
  • Description: The SIV gag gene was used in generation of a recombinant vector vaccine (Ami et al., 2005).
  • Detailed Gene Information: Click here.
g. Immunization Route
Intradermal injection (i.d.)
h. Macaque Response
  • Host Strain: Macaca fascicularis
  • Vaccination Protocol: The macaques were divided into 5 groups. Group 1 (control group) received rBCG-PSO246 followed by two inoculations of rDIsLacZ. Group 2 (rBCG group) received rBCG-SIVgag followed by two inoculations of rDIsLacZ. Group 3 (rBCG/rDIs group) received rBCG-SIVgag followed by two inoculations of rDIsSIVgag. Group 4 (rDIS group) received two inoculations of rDIsSIVgag followed by rBCG-pSO246. Group 5 (rDIs/rBCG group) received two inoculations of rDIsSIVgag followed by rBCG-SIVgag (Ami et al., 2005).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: All groups were mucosally challenged with two thousand 50% tissue culture infectious doses of SHIV KS661c at 64 weeks after immunization, these were intrarectally administered (Ami et al., 2005).
  • Efficacy: Only the macaques in group 3 (rBCG/rDIs) showed evidence of protective immune responses, the macaques in this group remained clinically healthy for a one year observation period. During this same observation period, by day 170, 6 macaques in the other 4 groups had died with symptoms consistent with simian AIDS. The rBCG/rDIs group vaccinated with the priming-boosting regimen had a superior survival rate than the other groups receiving vaccine protocols and the control group (Ami et al., 2005).
2. rMVA-SIV-CD40L
a. Vaccine Ontology ID:
VO_0004664
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Immunization Route
Intramuscular injection (i.m.)
3. SabRV-SIV
a. Vaccine Ontology ID:
VO_0004704
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Gene Engineering of env
  • Type: Recombinant vector construction
  • Description: To construct pSabRV1, first the EcoRI and XhoI sites upstream of the T7 promoter of pS1 were eliminated to create plasmid pS1XT. Then the 747-bp BstEII fragment of pMoV2.11—containing the duplicated 2Apro cleavage site, the 5-glycine spacer, and the EcoRI, NotI, and XhoI cloning sites—was swapped into pS1XT to create pSabRV1 (Crotty et al., 2001).
  • Detailed Gene Information: Click here.
f. Gene Engineering of env receptor binding subunit
  • Type: Recombinant vector construction
  • Description: To construct pSabRV1, first the EcoRI and XhoI sites upstream of the T7 promoter of pS1 were eliminated to create plasmid pS1XT. Then the 747-bp BstEII fragment of pMoV2.11—containing the duplicated 2Apro cleavage site, the 5-glycine spacer, and the EcoRI, NotI, and XhoI cloning sites—was swapped into pS1XT to create pSabRV1 (Crotty et al., 2001).
  • Detailed Gene Information: Click here.
g. Gene Engineering of gag-pol
  • Type: Recombinant vector construction
  • Description: To construct pSabRV1, first the EcoRI and XhoI sites upstream of the T7 promoter of pS1 were eliminated to create plasmid pS1XT. Then the 747-bp BstEII fragment of pMoV2.11—containing the duplicated 2Apro cleavage site, the 5-glycine spacer, and the EcoRI, NotI, and XhoI cloning sites—was swapped into pS1XT to create pSabRV1 (Crotty et al., 2001).
  • Detailed Gene Information: Click here.
h. Preparation
New poliovirus vectors based on Sabin 1 and 2 vaccine strain viruses were constructed, and these vectors were used to generate a series of new viruses containing SIV gag, pol, env, nef, and tat in overlapping fragments (Crotty et al., 2001).
i. Immunization Route
Intramuscular injection (i.m.)
j. Macaque Response
  • Vaccination Protocol: Seven animals were inoculated intranasally with 1 ml (5 × 107 PFU) of SabRV1-SIV on days 1, 3, 14, and 16, for a total of four immunizations. Nineteen weeks after the first series of inoculations, these same seven animals were given boosters of two intranasal inoculations of 1 ml (106 PFU/ml) of SabRV2-SIV, one at week 19 and a second at week 21 (Crotty et al., 2001).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: The animals were challenged with 105 TCID50 of SIVmac251 intravaginally, using the SIVmac251 (5/98) stock (Crotty et al., 2001).
  • Efficacy: Four of the seven vaccinated animals exhibited substantial protection against the vaginal SIV challenge (Crotty et al., 2001).
4. Simian Immunodeficiency Virus nef mutant vaccine
a. Vaccine Ontology ID:
VO_0002994
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Rhesus monkey
e. Gene Engineering of nef
  • Type: Gene mutation
  • Description: This nef mutant is from Simian Immunodeficiency Virus (Daniel et al., 1992).
  • Detailed Gene Information: Click here.
f. Immunization Route
Intravenous injection (i.v.)
g. Monkey Response
  • Persistence: A nef mutant is attenuated in rhesus monkeys (Daniel et al., 1992).
  • Efficacy: A nef mutant induces protection in rhesus monkeys from challenge with wild type SIV (Daniel et al., 1992).
5. SIV DNA vaccine pSIVgag and pmacIL-15 encoding SIV core protein
a. Vaccine Ontology ID:
VO_0004346
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Macaque
e. Gene Engineering of Core protein
  • Type: DNA vaccine construction
  • Description: This DNA vaccine expressed a 37-kDa fragment of the SIV core protein (Boyer et al., 2007).
  • Detailed Gene Information: Click here.
f. Vector:
pCSIVgag plasmid (Boyer et al., 2007)
g. Immunization Route
Intramuscular injection (i.m.)
h. Macaque Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: The vaccine groups were protected from ongoing infection, and the IL-15 covaccinated group showed a more rapidly controlled infection than the group treated with DNA vaccine alone (Boyer et al., 2007).
6. SIV DNA vaccine pVacc4 encoding env from mac239
a. Vaccine Ontology ID:
VO_0004343
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Macaque
e. Gene Engineering of env
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
pVacc4, modified vaccinia virus Ankara (MVA) (Bertley et al., 2004)
g. Immunization Route
oculo-nasal route
h. Macaque Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: After rectal challenge of vaccinated and naive animals with SHIV89.6P, all animals became infected. However a subset were protected from CD4+ T cell loss and AIDS development. Thus, nasal vaccination with SHIV-DNA plus IL-2/Ig DNA and rMVA can provide significant protection from disease progression (Bertley et al., 2004).
7. SIV recombinant vector vaccine rAd5/rLCMV
a. Vaccine Ontology ID:
VO_0004564
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Macaques
e. Antigen
a mismatched SIV envelope (Env) gene derived from simian immunodeficiency virus SIVmac239 (Flatz et al., 2012)
f. Vector:
Recombinant adenovirus type 5 (rAd5) priming, replication-defective lymphocytic choriomeningitis virus boosting (Flatz et al., 2012)
g. Immunization Route
Intramuscular injection (i.m.)
h. Macaque Response
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: Recombinant adenovirus type 5 (rAd5) prime followed by replication-defective lymphocytic choriomeningitis virus (rLCMV) boost elicited robust CD4 and CD8 T-cell and humoral immune responses. In addition, there was a presence of neutralizing antibodies to the challenge viruses tested in peripheral blood mononuclear cells (Flatz et al., 2012).
  • Efficacy: To evaluate the infectibility of immunized and control animals, 10 vaccinated Macaca mulatta animals and 10 controls were challenged intrarectally with SIVsmE660 six weeks after the rLCMV boost. In the vaccinated group, three of the 10 monkeys became infected after 99 challenges (3% infection rate per challenge), while in the control null group, eight of the 10 monkeys were infected after 47 challenges (17% infection rate per challenge), indicating a protective efficacy of 82% per challenge (Flatz et al., 2012).
IV. References
1. Ami et al., 2005: Ami Y, Izumi Y, Matsuo K, Someya K, Kanekiyo M, Horibata S, Yoshino N, Sakai K, Shinohara K, Matsumoto S, Yamada T, Yamazaki S, Yamamoto N, Honda M. Priming-boosting vaccination with recombinant Mycobacterium bovis bacillus Calmette-Guérin and a nonreplicating vaccinia virus recombinant leads to long-lasting and effective immunity. Journal of virology. 2005; 79(20); 12871-12879. [PubMed: 16188989].
2. Barouch et al., 2000: Barouch DH, Santra S, Schmitz JE, Kuroda MJ, Fu TM, Wagner W, Bilska M, Craiu A, Zheng XX, Krivulka GR, Beaudry K, Lifton MA, Nickerson CE, Trigona WL, Punt K, Freed DC, Guan L, Dubey S, Casimiro D, Simon A, Davies ME, Chastain M, Strom TB, Gelman RS, Montefiori DC, Lewis MG, Emini EA, Shiver JW, Letvin NL. Control of viremia and prevention of clinical AIDS in rhesus monkeys by cytokine-augmented DNA vaccination. Science (New York, N.Y.). 2000; 290(5491); 486-492. [PubMed: 11039923].
3. Barouch et al., 2000: Barouch DH, Craiu A, Kuroda MJ, Schmitz JE, Zheng XX, Santra S, Frost JD, Krivulka GR, Lifton MA, Crabbs CL, Heidecker G, Perry HC, Davies ME, Xie H, Nickerson CE, Steenbeke TD, Lord CI, Montefiori DC, Strom TB, Shiver JW, Lewis MG, Letvin NL. Augmentation of immune responses to HIV-1 and simian immunodeficiency virus DNA vaccines by IL-2/Ig plasmid administration in rhesus monkeys. Proceedings of the National Academy of Sciences of the United States of America. 2000; 97(8); 4192-4197. [PubMed: 10759543].
4. Bertley et al., 2004: Bertley FM, Kozlowski PA, Wang SW, Chappelle J, Patel J, Sonuyi O, Mazzara G, Montefiori D, Carville A, Mansfield KG, Aldovini A. Control of simian/human immunodeficiency virus viremia and disease progression after IL-2-augmented DNA-modified vaccinia virus Ankara nasal vaccination in nonhuman primates. Journal of immunology (Baltimore, Md. : 1950). 2004; 172(6); 3745-3757. [PubMed: 15004179].
5. Boyer et al., 2005: Boyer JD, Robinson TM, Kutzler MA, Parkinson R, Calarota SA, Sidhu MK, Muthumani K, Lewis M, Pavlakis G, Felber B, Weiner D. SIV DNA vaccine co-administered with IL-12 expression plasmid enhances CD8 SIV cellular immune responses in cynomolgus macaques. Journal of medical primatology. 2005; 34(5-6); 262-270. [PubMed: 16128921].
6. Boyer et al., 2007: Boyer JD, Robinson TM, Kutzler MA, Vansant G, Hokey DA, Kumar S, Parkinson R, Wu L, Sidhu MK, Pavlakis GN, Felber BK, Brown C, Silvera P, Lewis MG, Monforte J, Waldmann TA, Eldridge J, Weiner DB. Protection against simian/human immunodeficiency virus (SHIV) 89.6P in macaques after coimmunization with SHIV antigen and IL-15 plasmid. Proceedings of the National Academy of Sciences of the United States of America. 2007; 104(47); 18648-18653. [PubMed: 18000037].
7. Chong et al., 2007: Chong SY, Egan MA, Kutzler MA, Megati S, Masood A, Roopchard V, Garcia-Hand D, Montefiori DC, Quiroz J, Rosati M, Schadeck EB, Boyer JD, Pavlakis GN, Weiner DB, Sidhu M, Eldridge JH, Israel ZR. Comparative ability of plasmid IL-12 and IL-15 to enhance cellular and humoral immune responses elicited by a SIVgag plasmid DNA vaccine and alter disease progression following SHIV(89.6P) challenge in rhesus macaques. Vaccine. 2007; 25(26); 4967-4982. [PubMed: 17335943].
8. Crotty et al., 2001: Crotty S, Miller CJ, Lohman BL, Neagu MR, Compton L, Lu D, Lü FX, Fritts L, Lifson JD, Andino R. Protection against simian immunodeficiency virus vaginal challenge by using Sabin poliovirus vectors. Journal of virology. 2001; 75(16); 7435-7452. [PubMed: 11462016].
9. Daniel et al., 1992: Daniel MD, Kirchhoff F, Czajak SC, Sehgal PK, Desrosiers RC. Protective effects of a live attenuated SIV vaccine with a deletion in the nef gene. Science (New York, N.Y.). 1992; 258(5090); 1938-1941. [PubMed: 1470917].
10. Flatz et al., 2012: Flatz L, Cheng C, Wang L, Foulds KE, Ko SY, Kong WP, Roychoudhuri R, Shi W, Bao S, Todd JP, Asmal M, Shen L, Donaldson M, Schmidt SD, Gall JG, Pinschewer DD, Letvin NL, Rao S, Mascola JR, Roederer M, Nabel GJ. Gene-based vaccination with a mismatched envelope protects against simian immunodeficiency virus infection in nonhuman primates. Journal of virology. 2012; 86(15); 7760-7770. [PubMed: 22593152].
11. Kwa et al., 2014: Kwa S, Lai L, Gangadhara S, Siddiqui M, Pillai VB, Labranche C, Yu T, Moss B, Montefiori DC, Robinson HL, Kozlowski PA, Amara RR. CD40L-adjuvanted DNA/MVA SIV239 vaccine enhances SIV-specific humoral and cellular immunity, and improves protection against a heterologous SIVE660 mucosal challenge. Journal of virology. 2014; ; . [PubMed: 24920805].
12. Lu et al., 1996: Lu S, Arthos J, Montefiori DC, Yasutomi Y, Manson K, Mustafa F, Johnson E, Santoro JC, Wissink J, Mullins JI, Haynes JR, Letvin NL, Wyand M, Robinson HL. Simian immunodeficiency virus DNA vaccine trial in macaques. Journal of virology. 1996; 70(6); 3978-3991. [PubMed: 8648735].
13. Wiki: Simian immunodeficiency virus: Simian immunodeficiency virus [http://en.wikipedia.org/wiki/Simian_immunodeficiency_virus]