VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Lymphocytic choriomeningitis virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. nucleoprotein (Other)
    2. NP (Protective antigen)
  3. Vaccine Information
    1. Lymphocytic choriomeningitis virus DNA vaccine pCMV-NP
  4. References
I. General Information
1. NCBI Taxonomy ID:
11623
2. Disease:
Lymphocytic choriomeningitis
3. Introduction
Lymphocytic choriomeningitis, or LCM, is a rodent-borne viral infectious disease that presents as aseptic meningitis (inflammation of the membrane, or meninges, that surrounds the brain and spinal cord), encephalitis (inflammation of the brain), or meningoencephalitis (inflammation of both the brain and meninges). Its causative agent is the lymphocytic choriomeningitis virus (LCMV), a member of the family Arenaviridae that was initially isolated in 1933. Although LCMV is most commonly recognized as causing neurological disease, as its name implies, infection without symptoms or mild febrile illnesses are common clinical manifestations. Additionally, pregnancy-related infection has been associated with congenital hydrocephalus, chorioretinitis, and mental retardation.

The primary host is the common house mouse, Mus musculus. Infection in house mouse populations may vary by geographic location; about 5% of mice throughout the United States carry LCMV. The virus is found in the saliva, urine, and feces of infected mice. Infected mice carry LCMV and shed it for the duration of their lives without showing any sign of illness. Other types of rodents, such as hamsters, are not the natural reservoirs but can become infected with LCMV from wild mice at the breeder, in the pet store or home environment. Humans are more likely to contract LCMV from house mice, but infections from pet rodents have also been reported.

Individuals become infected with LCMV after exposure to fresh urine, droppings, saliva, or nesting materials. Transmission can also occur when these materials are directly introduced into broken skin, the nose, the eyes, or the mouth, or presumably, via the bite of an infected rodent. Person-to-person transmission has not been reported, with the exception of vertical transmission from infected mother to fetus. Recent investigations indicate that organ transplantation may also be a means of transmission (CDC - LCMV).
1. NP
  • Gene Name : NP
  • Sequence Strain (Species/Organism) : Lymphocytic choriomeningitis virus Armstrong
  • NCBI Protein GI : 61655717
  • Other Database IDs : CDD:279216
  • Taxonomy ID : 11623
  • Gene Strand (Orientation) : ?
  • Protein Name : nucleoprotein
  • Protein pI : 8.92
  • Protein Weight : 58776.522
  • Protein Length : 639
  • Protein Note : Arenavirus nucleocapsid protein; pfam00843
  • Protein Sequence : Show Sequence
    >AAX49342.1 nucleoprotein [Lymphocytic choriomeningitis mammarenavirus]
    MSLSKEVKSFQWTQALRRELQSFTSDVKAAVIKDATNLLNGLDFSEVSNVQRIMRKEKRDDKDLQRLRSL
    NQTVHSLVDLKSTSKKNVLKVGRLSAEELMSLAADLEKLKAKIMRSERPQASGVYMGNLTTQQLDQRSQI
    LQIVGMRKPQQGASGVVRVWDVKDSSLLNNQFGTMPSLTMACMAKQSQTPLNDVVQALTDLGLLYTVKYP
    NLNDLERLKDKHPVLGVITEQQSSINISGYNFSLGAAVKAGAALLDGGNMLESILIKPSNSEDLLKAVLG
    AKRKLNMFVSDQVGDRNPYENILYKVCLSGEGWPYIACRTSIVGRAWENTTIDLTSEKPAVNSPRPAPGA
    AGPPQVGLSYSQTMLLKDLMGGIDPNAPTWIDIEGRFNDPVEIAIFQPQNGQFIHFYREPVDQKQFKQDS
    KYSHGMDLADLFNAQPGLTSSVIGALPQGMVLSCQGSDDIRKLLDSQNRKDIKLIDVEMTREASREYEDK
    VWDKYGWLCKMHTGIVRDKKKKEITPHCALMDCIIFESASKARLPDLKTVHNILPHDLIFRGPNVVTL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Lymphocytic choriomeningitis virus DNA vaccine pCMV-NP
2. nucleoprotein
  • Gene Name : nucleoprotein
  • Sequence Strain (Species/Organism) : Lymphocytic choriomeningitis virus
  • NCBI Gene ID : 956592
  • NCBI Protein GI : 23334590
  • Locus Tag : LCMVsSgp2
  • Genbank Accession : DQ361065
  • Protein Accession : NP_694852
  • Taxonomy ID : 11623
  • Segment No : segment S
  • Gene Starting Position : 1638
  • Gene Ending Position : 3314
  • Gene Strand (Orientation) : -
  • Protein Name : nucleoprotein
  • Protein pI : 8.92
  • Protein Weight : 58406.41
  • Protein Length : 558
  • DNA Sequence : Show Sequence
    >gi|23334588:1638-3314 Lymphocytic choriomeningitis virus segment S, complete sequence
    CTTAGAGTGTCACAACATTTGGGCCTCTAAAAATTAGGTCATGTGGCAGAATGTTGTGAACAGTTTTCAG
    ATCTGGGAGCCTTGCTTTGGAGGCGCTTTCAAAAATGATGCAGTCCATGAGTGCACAGTGCGGGGTGATC
    TCTTTCTTCTTTTTGTCCCTTACTATTCCAGTATGCATCTTACACAACCAGCCATATTTGTCCCACACTT
    TGTCTTCATACTCCCTCGAAGCTTCCCTGGTCATTTCAACATCGATAAGCTTAATGTCCTTCCTATTCTG
    TGAGTCCAGAAGCTTTCTGATGTCATCGGAGCCTTGACAGCTTAGAACCATCCCCTGCGGAAGAGCACCT
    ATAACTGACGAGGTCAACCCGGGTTGCGCATTGAAGAGGTCGGCAAGATCCATGCCGTGTGAGTACTTGG
    AATCTTGCTTGAATTGTTTTTGATCAACGGGTTCCCTGTAAAAGTGTATGAACTGCCCGTTCTGTGGTTG
    GAAAATTGCTATTTCCACTGGATCATTAAATCTACCCTCAATGTCAATCCATGTAGGAGCGTTGGGGTCA
    ATTCCTCCCATGAGGTCTTTTAAAAGCATTGTCTGGCTGTAGCTTAAGCCCACCTGAGGTGGACCTGCTG
    CTCCAGGCGCTGGCCTGGGTGAATTGACTGCAGGTTTCTCGCTTGTGAGATCAATTGTTGTGTTTTCCCA
    TGCTCTCCCCACAATCGATGTTCTACAAGCTATGTATGGCCATCCTTCACCTGAAAGGCAAACTTTATAG
    AGGATGTTTTCATAAGGGTTCCTGTCCCCAACTTGGTCTGAAACAAACATGTTGAGTTTTCTCTTGGCCC
    CGAGAACTGCCTTCAAGAGGTCCTCGCTGTTGCTTGGCTTGATCAAAATTGACTCTAACATGTTACCCCC
    ATCCAACAGGGCTGCCCCTGCCTTCACGGCAGCACCAAGACTAAAGTTATAGCCAGAAATGTTGATGCTG
    GACTGCTGTTCAGTGATGACCCCCAGAACTGGGTGCTTGTCTTTCAGCCTTTCAAGATCATTAAGATTTG
    GATACTTGACTGTGTAAAGCAAGCCAAGGTCTGTGAGCGCTTGTACAACGTCATTGAGCGGAGTCTGTGA
    CTGTTTGGCCATACAAGCCATAGTTAGACTTGGCATTGTGCCAAATTGATTGTTCAAAAGTGATGAGTCT
    TTCACATCCCAAACTCTTACCACACCACTTGCACCCTGCTGAGGCTTTCTCATCCCAACTATCTGTAGGA
    TCTGAGATCTTTGGTCTAGTTGCTGTGTTGTTAAGTTCCCCATATATACCCCTGAAGCCTGGGGCCTTTC
    AGACCTCATGATCTTGGCCTTCAGCTTCTCAAGGTCAGCCGCAAGAGACATCAGTTCTTCTGCACTGAGC
    CTCCCCACTTTCAAAACATTCTTCTTTGATGTTGACTTTAAATCCACAAGAGAATGTACAGTCTGGTTGA
    GACTTCTGAGTCTCTGTAGGTCTTTGTCATCTCTCTTTTCCTTCCTCATGATCCTCTGAACATTGCTGAC
    CTCAGAGAAGTCCAACCCATTCAGAAGGTTGGTTGCATCCTTAATGACAGCAGCCTTCACATCTGATGTG
    AAGCTCTGCAATTCTCTTCTCAATGCTTGCGTCCATTGGAAGCTCTTAACTTCCTTAGACAAGGACA
  • Protein Sequence : Show Sequence
    >gi|23334590|ref|NP_694852.1| nucleoprotein [Lymphocytic choriomeningitis virus]
    MSLSKEVKSFQWTQALRRELQSFTSDVKAAVIKDATNLLNGLDFSEVSNVQRIMRKEKRDDKDLQRLRSL
    NQTVHSLVDLKSTSKKNVLKVGRLSAEELMSLAADLEKLKAKIMRSERPQASGVYMGNLTTQQLDQRSQI
    LQIVGMRKPQQGASGVVRVWDVKDSSLLNNQFGTMPSLTMACMAKQSQTPLNDVVQALTDLGLLYTVKYP
    NLNDLERLKDKHPVLGVITEQQSSINISGYNFSLGAAVKAGAALLDGGNMLESILIKPSNSEDLLKAVLG
    AKRKLNMFVSDQVGDRNPYENILYKVCLSGEGWPYIACRTSIVGRAWENTTIDLTSEKPAVNSPRPAPGA
    AGPPQVGLSYSQTMLLKDLMGGIDPNAPTWIDIEGRFNDPVEIAIFQPQNGQFIHFYREPVDQKQFKQDS
    KYSHGMDLADLFNAQPGLTSSVIGALPQGMVLSCQGSDDIRKLLDSQNRKDIKLIDVEMTREASREYEDK
    VWDKYGWLCKMHTGIVRDKKKKEITPHCALMDCIIFESASKARLPDLKTVHNILPHDLIFRGPNVVTL
  • Molecule Role : Other
III. Vaccine Information
1. Lymphocytic choriomeningitis virus DNA vaccine pCMV-NP
a. Vaccine Ontology ID:
VO_0004327
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of NP
  • Type: DNA vaccine construction
  • Description: This DNA vaccine encodes the full-length LCMV Armstrong nucleoprotein (Hassett et al., 2000).
  • Detailed Gene Information: Click here.
f. Vector:
pCMV (Hassett et al., 2000)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Mice were injected i.m. with pCMV-NP, which was shown to protect from intracranial LCMV challenge (Hassett et al., 2000).
IV. References
1. CDC - LCMV: Lymphocytic Choriomeningitis [http://www.cdc.gov/ncidod/dvrd/spb/mnpages/dispages/lcmv/qa.htm]