VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Murine Cytomegalovirus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Introduction
  2. Vaccine Related Pathogen Genes
    1. gM (Protective antigen)
    2. gN (Protective antigen)
    3. IE1 (Protective antigen)
  3. Vaccine Information
    1. Murine cytomegalovirus DNA vaccine pcDNA-89 encoding pp89
    2. Murine cytomegalovirus DNA vaccine pgM-pgN
  4. References
I. General Information
1. NCBI Taxonomy ID:
10366
2. Introduction
Murine cytomegalovirus (MCMV) belongs to the genus cytomegalovirus (CMV) of the β-Herpesvirinae subfamily of the Herpesviridae family. CMVs are marked by strict species specificity, tropism for hematopoietic tissue and secretory glands, and a slow replication cycle. After the resolution of acute infection, CMVs establish persistent life-long infections characterized by alternate stages of virus productivity and latency. Although producing up to 200 potentially antigenic proteins during its sequential immediate early (IE), early (E) and late (L) phases of gene expression, transmission to a new host is achieved in the face of repeatedly primed antiviral immune responses.

The routes used by MCMV to enter the host have not yet been clearly determined. Infectious virus can easily be detected in saliva of chronically infected mice, and productive infection is confined to glandular epithelial cells of salivary glands for a prolonged period of time, even in a fully immunocompetent host. Therefore, it is likely that the saliva is the major source of virus for horizontal spread, and the major route of entry for MCMV is the epithelium of the gastrointestinal and the upper respiratory tract. Per oral infection of newborn mice with MCMV leads to virus spread similar to that following intraperitoneal virus administration, which confirms that MCMV can enter through the epithelium of the gastrointestinal and/or respiratory tract. In addition, sexual transmission of MCMV and viral entry through the epithelium of the genitourinary tract could be an important means of its horizontal spread. After entry into the host, the virus spreads haematologically to various organs and infects many different cell types, including epithelial and endothelial cells, myocytes, brown fat adipocytes, fibrocytes, macrophages and bone marrow (BM) stromal cells (Krmpotic et al., 2003).
1. gM
  • Gene Name : gM
  • Sequence Strain (Species/Organism) : Murid herpesvirus 1 strain Smith
  • NCBI Gene ID : 3293854
  • NCBI Protein GI : 61660210
  • Locus Tag : MuHV1_gp093
  • Genbank Accession : GU305914
  • Protein Accession : YP_214101
  • Taxonomy ID : 10366
  • Gene Starting Position : 144295
  • Gene Ending Position : 145410
  • Gene Strand (Orientation) : -
  • Protein Name : Glycoprotein M or integral membrane protein
  • Protein pI : 8.98
  • Protein Weight : 38877.66
  • Protein Length : 371
  • DNA Sequence : Show Sequence
    >gi|21716071:144295-145410 Murid herpesvirus 1, complete genome
    CTCACTCTGCGTCGCTTCGCAGGGCGCGTATCTCTTCGTTGTCCAGGGCCAGGGCTCGATATCGCTTGTT
    GCGGCGCAGCAAGAACCTCACCGTACGGATGACCGAGAACGCCACGCAGAGCAGTAGCAGCACCGTGATG
    CCGATGTTGATGTCCCTCGCGTAGCTCGAGGCGTTCAGCGCCTCGTAGCGGATGATGGGGTACATGGCGC
    CGCAGACGCCCAGTATCGTCCCGATGTGGTAGCCGAACTGCACCTTCATGTAGCGCGACAGCACCGACTC
    GATGATCGAGAAGTACACGCACGCCACGATCGCGAAGGCGACCATGGCGCCGAACACGACGTGCGCCGTC
    TTCACGAAAAAGCTGTTGCCGAAGCCGAGCGCCAGCGACATGGCCAGCACCATGGTCGCGAAGCCCAAGA
    TCAGCTGGGTCAGGTTCACCACCGCCGTCCGATAGCGGATGGTCCCCTGCAGCTTCGGGTGGATCTTCGA
    CAGCGCGAAAGCGCTGCGCTCGCGCGACTCGTAGTGGGTCACGAGCGTCACCACGAAGGCCGTCAGGCAC
    ATAAAGTACATGCACTTGCTGAACGCGACCATGGACGGTAGGCGGAACGACAGGCTCAGCAGGAAGATCT
    GAAAGGTGTCCATCGTCAGCACGAAGGTGAAGCACGTCGCCGAGTCGCCCATGAAGTTGATGTCGCGGGT
    CGACTGGTTCACCTGCGTGCCGTGCTCGCTGCGGAAGTAGATCTGCACCCAGCACACGATGTAGTAGCTC
    AGCACGCAGAAGAAGATCAGCTCCGTGAAGATCACGTACACGATGAGCTGCACGGGGTCCAGGAACAGCT
    GCGGCGTCAGATGGTGGATCGCGTTGTACATCGTCAGGTTCATGTTGTCGAAGTCGATGATGCGCGGGTA
    ATAGCACGGAAAACCGATGCCGGGGAAGTGCGCCGCCACCGAGAACACCACGATGTTCACGAACGACAGC
    AGGCAGCACGCGATGGCCATCGTCCACGTCCGCAGGTTCATGCGGTCCACGTGGGAGAGCGTCATGACGC
    CCGCTTTCGCCATCGTGCAGGTGTCTCGTGTCCGCGGTCGACGGGGCGGGTCAAATAGTGAGAGCA
  • Protein Sequence : Show Sequence
    >gi|61660210|ref|YP_214101.1| Glycoprotein M or integral membrane protein [Murid herpesvirus 1]
    MLSLFDPPRRPRTRDTCTMAKAGVMTLSHVDRMNLRTWTMAIACCLLSFVNIVVFSVAAHFPGIGFPCYY
    PRIIDFDNMNLTMYNAIHHLTPQLFLDPVQLIVYVIFTELIFFCVLSYYIVCWVQIYFRSEHGTQVNQST
    RDINFMGDSATCFTFVLTMDTFQIFLLSLSFRLPSMVAFSKCMYFMCLTAFVVTLVTHYESRERSAFALS
    KIHPKLQGTIRYRTAVVNLTQLILGFATMVLAMSLALGFGNSFFVKTAHVVFGAMVAFAIVACVYFSIIE
    SVLSRYMKVQFGYHIGTILGVCGAMYPIIRYEALNASSYARDINIGITVLLLLCVAFSVIRTVRFLLRRN
    KRYRALALDNEEIRALRSDAE
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Murine cytomegalovirus DNA vaccine pgM-pgN
2. gN
  • Gene Name : gN
  • Sequence Strain (Species/Organism) : Murine cytomegalovirus (strain Smith)
  • NCBI Protein GI : 190358890
  • Other Database IDs : CDD:112376
  • Taxonomy ID : 10367
  • Gene Strand (Orientation) : ?
  • Protein Name : Glycoprotein N
  • Protein Length : 139
  • Protein Note : gN; Structural glycoprotein UL73; gpUL73
  • Protein Sequence : Show Sequence
    >gi|190358890|sp|Q69150.2|GN_MUHVS RecName: Full=Glycoprotein N; Short=gN; AltName: Full=Structural glycoprotein UL73; Short=gpUL73
    MACGKTESGDDSGRFGRTGAGMFGFIMPGFVGIFRLSFFLLLSFAMASGSSSPASVPVSVAASVPDTTVN
    KIVISDGSEAHNINEFYDVKCHSHFYGLSVSSFASIWMMVNAIVFICAFGVFMRHWCYKAFTSDTAKGY
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Murine cytomegalovirus DNA vaccine pgM-pgN
3. IE1
  • Gene Name : IE1
  • Sequence Strain (Species/Organism) : Murine cytomegalovirus
  • NCBI Protein GI : 138479
  • Taxonomy ID : 10367
  • Gene Strand (Orientation) : ?
  • Protein Name : Immediate-early protein 1
  • Protein Length : 595
  • Protein Note : Immediate-early phosphoprotein PP89
  • Protein Sequence : Show Sequence
    >gi|138479|sp|P11210.1|VIE1_MUHVS RecName: Full=Immediate-early protein 1; Short=IE1; AltName: Full=Immediate-early phosphoprotein PP89
    MEPAAPSCNMIMIADQASVNAHGRHLDENRVYPSDKVPAHVANKILESGTETVRCDLTLEDMLGDYEYDD
    PTEEEKILMDRIADHVGNDNSDMAIKHAAVRSVLLSCKIAHLMIKQNYQSAINSATNILCQLANDIFERI
    ERQRKMIYGCFRSEFDNVQLGRLMYDMYPHFMPTNLGPSEKRVWMSYVGEAIVAATNIDHALDERAAWAK
    TDCSLPGEFKPELCVLVGAIRRLHDPPCYTKPFLDAKSQLAVWQQMKAIESESVSTHVVVVEALKLRENL
    AKAVQETIAYERHQYHRVCQMMCNNMKDHLETTCMLARGRTLATLADLRSTRYNLALFLLSEMHIFDSFT
    MPRIRGAMKQARCMSYVERTISLAKFRELADRVHNRSAPSPQGVIEEQQQAGEEEQQQQQEIEYDPEMPP
    LEREEEQEDEQVEEEPPADEEEGGAVGGVTQEEPAGEATEEAEEDESQPGPSDNQVVPESSETPTPAEDE
    ETQSADEGESQELEGSQQLILSRPAAPLTDSETDSDSEDDDEVTRIPVGFSLMTSPVLQPTTRSATAAAS
    SGTAPRPALKRQYAMVHTRSKSSENQQQPKKKSKK
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Murine cytomegalovirus DNA vaccine pcDNA-89 encoding pp89
III. Vaccine Information
1. Murine cytomegalovirus DNA vaccine pcDNA-89 encoding pp89
a. Vaccine Ontology ID:
VO_0004323
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of IE1
  • Type: DNA vaccine construction
  • Description: Vector pcDNAI/Amp expressed the murine cytomegalovirus (MCMV) immediate-early gene 1 (IE1) encodes an 89-kDa phosphoprotein (pp89) (González et al., 1996).
  • Detailed Gene Information: Click here.
f. Vector:
pcDNAI/Amp (González et al., 1996)
g. Immunization Route
Intradermal injection (i.d.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: In four separate trials, an average of 63% of the mice immunized with pcDNA-89 survived after lethal challenge, compared with 18% of the mice immunized with pcDNA (control) (González et al., 1996).
2. Murine cytomegalovirus DNA vaccine pgM-pgN
a. Vaccine Ontology ID:
VO_0004526
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Antigen
gM and gN from murine cytomegalovirus strain Smith (Wang et al., 2013)
f. Gene Engineering of gM
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Gene Engineering of gN
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
h. Vector:
pcDNA3.1 (Wang et al., 2013)
i. Immunization Route
Intramuscular injection (i.m.)
j. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Co-immunization with pgM and pgN three times at a high dose was able to provide mice with full protection against a lethal SG-MCMV challenge with a 100% survival rate. The protection obtained with the gM-gN co-immunization was far greater than each antigen alone (Wang et al., 2013).
IV. References
1. González et al., 1996: González Armas JC, Morello CS, Cranmer LD, Spector DH. DNA immunization confers protection against murine cytomegalovirus infection. Journal of virology. 1996; 70(11); 7921-7928. [PubMed: 8892915].
2. Krmpotic et al., 2003: Krmpotic A, Bubic I, Polic B, Lucin P, Jonjic S. Pathogenesis of murine cytomegalovirus infection. Microbes and infection / Institut Pasteur. 2003; 5(13); 1263-1277. [PubMed: 14623023].
3. Wang et al., 2013: Wang H, Yao Y, Huang C, Chen Q, Chen J, Chen Z. Immunization with cytomegalovirus envelope glycoprotein M and glycoprotein N DNA vaccines can provide mice with complete protection against a lethal murine cytomegalovirus challenge. Virologica Sinica. 2013; ; . [PubMed: 23715998].