VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Parainfluenza virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Introduction
  2. Vaccine Related Pathogen Genes
    1. Human metapneumovirus genome (Other)
    2. Human parainfluenza virus 1 genome (Other)
    3. HN (Protective antigen)
  3. Vaccine Information
  4. References
I. General Information
1. NCBI Taxonomy ID:
31605
2. Introduction
Human parainfluenza viruses (HPIVs) commonly cause upper and lower respiratory illnesses in infants and young children. But, anyone can get respiratory illness from HPIV.

Symptoms of upper respiratory illness may include fever, runny nose, and cough. HPIVs can cause more severe lower respiratory illness, such as croup or pneumonia. Young children are more likely to have these severe illnesses. But, older adults and people with weakened immune systems are also at risk.

You can have multiple HPIV illnesses in your lifetime.

HPIVs spread from person to person through close personal contact, in the air by coughing and sneezing, and by touching objects or surfaces that have HPIVs on them.

People usually get infected with HPIV in the spring, summer, and fall (CDC - Human Parainfluenza Viruses).
1. HN
  • Gene Name : HN
  • Sequence Strain (Species/Organism) : Parainfluenza virus
  • NCBI Protein GI : AAL89408
  • Other Database IDs : CDD:278832
  • Taxonomy ID : 188538
  • Protein Name : HN glycoprotein
  • Protein pI : 7.97
  • Protein Weight : 62004.5
  • Protein Length : 666
  • Protein Note : Haemagglutinin-neuraminidase; pfam00423
  • Protein Sequence : Show Sequence
    >AAL89408.1 HN glycoprotein [Human parainfluenza virus 1 strain Washington/1964]
    MAEKGKTNSSYWSTTRNDNSTVNTHINTPAGRTHIWLLIATTMHTVLSFIIMILCIDLIIKQDTCMKTNI
    MTVSSMNESAKIIKETITELIRQEVISRTINIQSSVQSGIPILLNKQSRDLTQLIEKSCNRQELAQICEN
    TIAIHHADGISPLDPHDFWRCPVGEPLLSNNPNISLLPGPSLLSGSTTISGCVRLPSLSIGDAIYAYSSN
    LITQGCADIGKSYQVLQLGYISLNSDMYPDLNPVISHTYDINDNRKSCSVIAAGTRGYQLCSLPTVNETT
    DYSSEGIEDLVFDILDLKGKTKSHRYKNEDITFDHPFSAMYPSVGSGIKIENTLIFLGYGGLTTPLQGDT
    KCVINRCTNVNQSVCNDALKITWLKKRQVVNVLIRINNYLSDRPKIVVETIPITQNYLGAEGRLLKLGKK
    IYIYTRSSGWHSNLQIGSLDINNPMTIKWAPHEVLSRPGNQDCNWYNRCPRECISGVYTDAYPLSPDAVN
    VATTTLYANTSRVNPTIMYSNTSEIINMLRLKNVQLEAAYTTTSCITHFGKGYCFHIVEINQASLNTLQP
    MLFKTSIPKICKITS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Kobayashi et al., 2013)
2. Human metapneumovirus genome
  • Gene Name : Human metapneumovirus genome
  • Sequence Strain (Species/Organism) : Human metapneumovirus
  • NCBI Nucleotide GI : 340008341
  • NCBI Protein GI : 340008342
  • Protein Accession : AEK26903.1
  • Taxonomy ID : 162145
  • Gene Strand (Orientation) : ?
  • Protein Name : N
  • Protein Note : genotype: B1
  • DNA Sequence : Show Sequence
    >gi|340008341|gb|JN184401.1| Human metapneumovirus strain TN982-42, complete genome
    ACGCGAAAAAAACGCGTATAAATTAAATTCCAAACAAAACGGGACAAATAAAAATGTCTCTTCAAGGGAT
    TCACCTAAGTGATCTATCATATAAACATGCTATATTAAAAGAGTCTCAATACACAATAAAAAGAGATGTA
    GGCACTACAACTGCAGTGACACCTTCATCATTGCAACAAGAAATAACACTTTTGTGTGGGGAAATTCTTT
    ACACTAAACACACTGATTACAAATATGCTGCTGAGATAGGAATACAATATATTTGCACAGCTCTAGGATC
    AGAAAGAGTACAACAGATTTTGAGAAACTCAGGTAGTGAAGTTCAGGTGATTCTAACCAAAACATACTCT
    TTAGGGAAAGGCAAAAACAGCAAAGGGGAAGAGTTGCAGATGTTAGATATACATGGAGTGGAAAAGAGTT
    GGGTAGAAGAAATAGACAAAGAGGCAAGAAAGACAATGGTAACTTTGCTTAAGGAATCATCAGGTAACAT
    TCCACAAAACCAGAGACCTTCAGCACCAGACACACCAATAATTTTATTATGTGTAGGTGCCCTAATATTC
    ACCAAACTAGCATCAACAATAGAAGTTGGATTAGAGACTACAGTTAGAAGAGCTAATAGAGTGCTAAGTG
    ATGCACTCAAAAGATACCCTAGAGTAGATATACCAAAGATTGCTAGATCTTTTTATGAACTATTTGAGCA
    AAAAGTGTACTACAGAAGTTTATTCATTGAGTATGGAAAAGCTTTAGGCTCATCTTCAACAGGAAGCAAA
    GCAGAAAGTTTGTTTGTAAATATATTTATGCAAGCTTATGGAGCTGGTCAAACATTGCTAAGGTGGGGTG
    TCATTGCCAGATCATCCAATAACATAATGCTAGGGCATGTATCTGTGCAATCTGAATTGAAGCAGGTTAC
    AGAGGTTTATGACTTGGTGAGAGAAATGGGTCCTGAATCTGGGCTTTTACATCTAAGACAAAGTCCAAAG
    GCAGGGCTGTTATCGTTGGCCAATTGCCCCAATTTTGCTAGTGTTGTTCTTGGCAATGCTTCAGGTCTGG
    GCATAATCGGAATGTACAGAGGGAGAGTACCAAACACAGAGCTATTTTCTGCAGCAGAAAGTTATGCCAG
    AAGCTTAAAAGAAAGCAATAAAATCAACTTCTCCTCGTTAGGGCTTACAGATGAAGAAAAAGAAGCTGCA
    GAACACTTCTTAAACATGAGTGGTGACAATCAAGATGATTATGAGTAATTAAAAAACTGGGACAAGTCAA
    AATGTCATTCCCTGAAGGAAAGGATATCCTGTTCATGGGTAATGAAGCAGCAAAAATAGCCGAAGCTTTC
    CAGAAATCACTAAAAAAATCAGGTCACAAGAGAACTCAATCTATTGTAGGGGAAAAAGTAAGCACTATAT
    CAGAAACTCTAGAATTACCTACCATCAGCAAACCTGCACGATCATCTACACTGCTGGAACCAAAATTGGC
    ATGGGCAGACAACAGCGGAGTCACCAAAATCACAGAAAAACCAGCAACCAAAACAACAGATCCTGCTGAA
    GAAGAGGAATTCAGTGAAAAGAAAGCATTGCCTTCCAGTGATGGAAAGACTCCTGCAGAGAAAAAATCAA
    AGTTTTCAACCAGTGTAAAAAAGAAAGTTTCCTTTACATCAAATGAACCAGGGAAATATACCAAGCTAGA
    GAAAGATGCCCTAGATTTGCTCTCAGACAATGAGGAAGAAGACGCAGAATCCTCAATCCTAACCTTTGAG
    GAGAAAGATACATCATCACTAAGCATTGAAGCCAGACTAGAATCTATAGAAGAGAAGTTGAGCATGATAT
    TAGGACTGCTTCGTACACTTAACATTGCAACAGCAGGACCAACAGCTGCACGAGATGGAATCAGAGATGC
    AATGATTGGTATAAGAGAAGAACTAATAGCAGAGATAATTAAGGAAGCCAAGGGAAAAGCAGCTGAAATG
    ATGGAAGAAGAGATGAATCAAAGATCAAAAATAGGAAATGGCAGTGTAAAACTAACCGAGAAGGCAAAAG
    AGCTCAACAAAATTGTTGAAGACGAGAGCACAAGCGGTGAATCAGAAGAAGAAGAAGAACCAAAAGAAAC
    TCAGGATAACAATCAAGGAGAAGATATTTATCAGTTAATCATGTAGTTTAATAAAAATAAACAACGGGAC
    AAGTCAAGATGGAGTCCTATCTGGTGGACACTTATCAAGGCATCCCATATACAGCTGCTGTTCAAGTTGA
    CCTGGTAGAAAAAGATTTACTGCCAGCAAGTTTGACAATATGGTTTCCTTTATTTCAGGCTAACACACCA
    CCAGCAGTCTTGCTTGATCAGCTAAAAACCTTGACAATAACAACTCTGTATGCTGCATCACAGAATGGTC
    CAATACTCAAGGTAAATGCATCTGCCCAAGGTGCTGCCATGTCTGTACTTCCCAAAAAATTCGAGGTAAA
    TGCAACTGTAGCACTTGATGAGTACAGCAAACTTGACTTTGACAAGCTGACGGTTTGCGATGTTAAAACA
    GTTTATTTGACAACTATGAAACCGTACGGGATGGTGTCAAAATTTGTGAGCTCAGCCAAATCAGTTGGCA
    AAAAGACACATGATCTAATTGCACTATGTGACTTCATGGACCTAGAGAAAAATATACCTGTGACAATACC
    AGCATTCATAAAGTCAGTTTCAATCAAAGAGAGTGAGTCAGCCACTGTTGAAGCTGCAATAAGCAGTGAA
    GCCGACCAAGCCTTGACACAAGCCAAGATTGCGCCCTATGCAGGACTAATTATGATCATGGCCATGAACA
    ATCCAAAAGGTATATTCAAGAAACTAGGAGCTGGAACACAAGTGATAGTAGAGCTGGGGGCATATGTTCA
    GGCTGAGAGCATCAGCAGGATCCGCAAGAGCTGGAGTCACCAAGGAACAAGATATGTCCTAAAATCCAGA
    TAAAAATAACTATCTTAATCAATAATTGCTTATATAACTCCAAAGATTAATAAGCTTATTACTATAGTTA
    TATAAAAATAAATTAGACTTAGAAGGGCATCAATAGAAAGCGGGACAAATAAAAATGTCTTGGAAAGTGA
    TGATCATCATTTCGTTACTCATAACACCCCAGCACGGGCTAAAGGAGAGTTATTTGGAAGAATCATGCAG
    TACTATAACTGAGGGATACCTCAGTGTTTTAAGAACAGGCTGGTACACTAATGTCTTTACATTAGAAGTT
    GGTGATGTTGAAAATCTTACATGTACTGATGGACCTAGCTTAATCAAAACAGAACTTGATCTAACAAAAA
    GTGCTTTAAGGGAACTCAAAACAGTCTCTGCTGATCAGTTAGCGAGAGAGGAGCAAATTGAAAATCCCAG
    ACAATCAAGATTTGTCCTAGGTGCAATAGCCCTCGGAGTTGCTACAGCAGCAGCAGTCACAGCAGGCATT
    GCAATAGCCAAAACCATAAGGCTTGAGAGTGAAGTGAATGCAATCAAAGGTGCTCTCAAACAAACTAATG
    AAGCAGTATCCACATTAGGAAATGGAGTGCGGGTCCTAGCCACTGCAGTGAGAGAGCTGAAAGAATTTGT
    GAGCAAAAATCTGACTAGTGCAATCAACAAGAACAAATGTGACATTGCTGATCTGAAGATGGCTGTCAGC
    TTCAGTCAATTCAACAGAAGATTTCTAAATGTTGTGCGGCAGTTTTCAGACAATGCAGGAATAACACCAG
    CAATATCATTGGACCTAATGACTGATGCTGAGTTGGCCAGAGCTGTATCATACATGCCAACATCTGCAGG
    ACAGATAAAACTGATGTTGGAGAACCGCGCAATGGTAAGGAGGAAAGGATTTGGAATCCTGATAGGGGTC
    TACGGAAGCTCTGTGATTTACATGGTTCAATTGCCGATCTTTGGTGTCATAGATACACCTTGTTGGATAA
    TCAAGGCAGCTCCCTCTTGCTCAGAAAAAAACGGGAATTATGCTTGCCTCCTAAGAGAGGATCAAGGGTG
    GTATTGTAAAAATGCAGGATCCACCGTTTACTACCCAAATGAAAAAGACTGCGAAACAAGAGGTGATCAT
    GTTTTTTGTGACACAGCAGCAGGGATCAATGTTGCTGAGCAATCAAGAGAATGCAACATCAACATATCCA
    CTACCAACTACCCATGCAAAGTCAGCACAGGAGGACACCCTATAAGTATGGTTGCACTATCACCTCTTGG
    CGCTTTGGTGGCTTGCTATAAAGGGGTAAGCTGCTCAATTGGCAGCAATCGGGTTGGAATCATCAAACAA
    TTACCTAAAGGCTGCTCATACATAACCAACCAGGATGCAGACACTGTAACAATTGACAACACCGTGTATC
    AACTAAGCAAAGTTGAAGGTGAACAGCATGTAATAAAAGGGAGACCAGTTTCAAGCAGCTTTGATCCAAT
    CAGGTTTCCTGAGGATCAGTTCAATGTTGCGCTTGATCAAGTCTTTGAAAGTATTGAGAACAGTCAGGCA
    CTAGTGGATCAGTCAAACAGAATTCTAAACAGTGCAGAAAAAGGAAACACTGGCTTCATTATTGTAATAA
    TTTTGGTTGCTGTTCTTGGTTTAACCATGATTTCAGTGAGCATCATCATCATAATCAAGAAAACAAAGAA
    GCCCAAAGGAGCACCTCCAGAGCTGAATGGTGTCACCAACGGAGGTTTCATACCACATAGTTAGTTAATT
    AAAAAATGGGACAAATCATCATGTCTCGTAAAGCTCCATGCAAATATGAAGTGCGGGGCAAATGCAACAG
    AGGGAGTGATTGCAAGTTCAATCACAATTACTGGAGTTGGCCTGATAGATATTTATTGTTAAGATCAAAT
    TATCTCTTGAATCAGCTTTTAAGAAACACTGACAAGGCTGATGGTTTGTCAATAATATCAGGAGCAGGTA
    GAGAAGATAGAACTCAAGACTTTGTTCTTGGTTCTACCAATGTGGTTCAAGGGTACATTGATGACAATCA
    AGGAATAACCAAGGCTGCGGCTTGCTATAGTCTACACAACATAATCAAGCAACTACAAGAAACAGAAGTA
    AGACAGGCTAGAGACAACAAGCTTTCTGATAGCAAACATGTGGCGCTCCACAACTTGATATTATCCTATA
    TGGAGATGAGCAAAACTCCTGCATCTCTAATTAACAACCTAAAGAAACTACCAAGGGAAAAACTGAAGAA
    ATTAGCAAGATTAATAATTGATTTATCAGCAGGAACTGACAATGACCCTTCATATGCCTTGCAAGACAGT
    GAAAGCACTAATCAAGTGCAGTAAACATGGTCCCAAATTCATTACCATAGAGGCAGATGATATGATATGG
    ACTCACAAAGAATTAAAAGAAGCACTGTCTGATGGGATAGTAAAATCACACACTAATATTTATAGTTGTT
    ACTTAGAAAACATAGAAATAATATATGTTAAAGCTTACTTAAGTTAGTAAAAAATAAAAATAGAATGGGA
    TAAATGACAATGAAAACATTAGATGTCATAAAAAGTGATGGACCCTCAGAAACGTGTAATCAACTCAAAA
    AAACAATAAAAAAACACTCGGGTAAAGTGCTTATTGCACTAAAACTGATATTGGCTTTACTGACATTTTT
    CACAGTAACAATTACTGTTAACTATATAAAAGTAGAAAACAATTTGCAGGCATGTCAATCAAAAAATGAA
    TCAGACAAAAAGGTCACAAAGTTAAATACTACATCAACAACAATCAGACCCATACCTGATCTAACTGTAG
    TACATTATTTGAAAAGGCTGATTCAGAGACACACCAACTTTGTCATAAAAGACAGTGATACTTGTTGGAG
    AATACACAAGAATCAATGTACAAATATAAAAATATACAAGTTCTTATGTTTTGGGTTCATAAATTCAACA
    GGTACAGATTGTGAGGAACTAACAGCCTTATGCAACAAAAAGTTAAAAACTATGGCAGGAAAACATAGAA
    AGGCAGAATGTCACTGTCTACATACAACCGAGTGGGGGTGCTATTATCTTTAAAATAACACGGCTTTCAA
    CATTAAAATCAGAACAAATTCTACCCAGGTCTATTAATACAGTGGTTTAGTTATTTAAAAACTAAATATT
    GTCTAGGCTGCGCGACACTTCGCAATAATATGCAATAGCCAATAATCAAACCAATGCTGCAAACTCATCC
    ATAATATAATCACTGAGTAATACAAAACAAGAAAATGGGACAAGTGGCTATGGAAGTAAGAGTGGAGAAC
    ATTCGAGCGATAGACATGTTCAAAGCAAAGATAAAAAACCGCATAAGAAGCAGCAGGTGCTATAGAAATG
    CTACACTGATCCTCATTGGACTAACAGCGCTAAGCATGGCACTTAATATTTTCCTGATCATTGATCATGC
    AACATTAAAAAACATGATCAAAACAGAAAACTGTGCTAACATGCCGTCAGCAGAACCAAGCAGAAAGACT
    CTGATGTCCTCCACAGCAGGCCCAAACACCAAACCCGATCCACAGCAAGCAACACAGTGGACTACAGAGA
    ACTCAACATCCCTAGCAGCAACCTCAGAAGGCTATCTATACACAGGGACAATTCAAACACCAGACACAAC
    AGCTCCCCAGCAAACCACAGACAAATACACAGCACTGCTGAAATCAACCAACGAACAGATCACCCAGACA
    ACCACAGAGAAAAAGACAACCAGAGCAGCAACCCAAAAAGGGAAAAAAGGGAAAGAAAACACAAACCAAA
    CTACAAGTACAGCTGCAACCCAAACAACCAACACCACCAACCAAACCAGAAATGCAAATGAGACAATCAC
    AACATCCGACAGACCCAGAACCGACATCACAACCCAAAGCAGCGAACAGACAACCCAGACAACAGACCCA
    AGCTCCCCACCACACTATGCGCAGAGAGGCGCACAACTCAAACAAACACAACACACAAACATCCCATCCA
    AGTAGTTAACAAAAAACCACAAAATAACCTTGAAAACCAAAAAACCAAAATGTAAATTTAAACCCAGAAA
    AACATAAACACTATATGGATGGTTTGAGCATATACACCAATGAAATAGCATCTGTTCATGTATCAATAGT
    ACTACCATTATTTAAGGAATAAGAAGAGGCAAAAATTCAAGGGATAAATGACAATGGATCCCTTTTGTGA
    ATCTACTGTTAATGTTTATCTCCCTGATTCATATCTCAAAGGAGTGATATCTTTTAGTGAAACCAACGCA
    ATTGGATCATGTCTTTTGAAAAGACCCTATCTAAAAAATGATAACACTGCTAAAGTTGCTGTAGAAAACC
    CTGTTGTTGAACATGTCAGGCTTAGAAATGCAGTCATGACCAAAATGAAGATATCAGATTATAAAGTGGT
    TGAACCAGTTAATATGCAACATGAAATAATGAAAAATATACACAGTTGTGAGCTTACATTATTAAAACAA
    TTCTTAACGAGAAGTAAAAATATTAGCTCTCTAAAATTAAATATGATATGTGATTGGTTACAGTTAAAAT
    CCACTTCAGATAACACATCAATTCTCAATTTTATAGATGTGGAGTTCATACCTGTTTGGGTGAGCAATTG
    GTTCAGTAACTGGTATAATCTCAATAAATTAATCTTAGAGTTTAGAAGAGAAGAAGTAATAAGAACTGGT
    TCAATTTTATGTAGATCACTAGGCAAGTTAGTTTTTATTGTATCATCTTATGGATGTGTAGTAAAAAGCA
    ACAAAAGTAAAAGAGTGAGCTTCTTCACCTATAACCAACTGTTAACATGGAAAGATGTGATGTTAAGTAG
    ATTCAATGCAAACTTTTGTATATGGGTAAGTAACAACCTGAACAAAAATCAAGGAGGACTAGGACTTAGA
    AGCAATCTGCAAGGTATGTTAACCAATAAATTATATGAAACTGTTGATTACATGCTAAGCCTATGCTGCA
    ATGAAGGATTCTCTCTGGTGAAAGAGTTCGAAGGATTTATTATGAGTGAAATTCTAAAAATTACTGAGCA
    TGCTCAATTCAGTACTAGGTTTAGGAATACTTTATTGAATGGGTTAACTGAGCAATTATCAGTGTTGAAA
    GCTAAAAACAGGTCTAGAGTTCTTGGAACTATATTAGAAAACAACAATTACCCTATGTATGAAGTAGTAC
    TTAAATTATTAGGGGACACCTTGAAAAGCATAAAGTTATTAATTAACAAGAATTTAGAAAATGCTGCAGA
    ATTATATTATATATTCAGAATTTTTGGACACCCTATGGTAGATGAGAGGGAAGCAATGGATGCTGTTAAA
    TTAAACAATGAGATTACAAAAATTCTTAAATTAGAGAGTTTAACAGAACTAAGAGGAGCATTTATACTAA
    GAATTATAAAAGGGTTTGTAGACAATAATAAAAGATGGCCTAAAATTAAGAATTTAAAAGTGCTCAGCAA
    AAGATGGGCTATGTATTTCAAAGCTAAAAGTTACCCTAGCCAACTTGAGCTAAGTGTACAAGATTTTCTA
    GAACTTGCTGCAGTGCAATTTGAGCAGGAATTCTCTGTACCTGAAAAAACCAACCTTGAGATGGTGTTAA
    ATGATAAAGCAATATCACCTCCAAAAAAGCTAATATGGTCTGTATATCCAAAAAACTATCTGCCTGAAAC
    TATAAAAAATCAATATTTAGAAGAGGCTTTCAATGCAAGTGACAGTCAAAGAACAAGGAGAGTCTTAGAA
    TTTTACTTAAAAGATTGTAAATTTGATCAAAAAGAACTTAAACGTTATGTAATTAAACAAGAGTATCTAA
    ATGACAAAGACCACATTGTCTCGTTAACTGGGAAGGAAAGAGAATTAAGTGTGGGTAGGATGTTTGCAAT
    GCAACCAGGAAAACAAAGACAAATACAGATACTAGCTGAGAAACTTCTAGCTGATAATATTGTACCTTTT
    TTCCCAGAAACTTTAACAAAGTATGGTGACTTAGATCTCCAAAGAATTATGGAAATAAAATCAGAACTTT
    CCTCTATTAAAACTAGAAAGAATGATAGCTACAACAATTATATTGCAAGAGCCTCTATAGTAACAGACTT
    AAGTAAGTTCAATCAGGCCTTTAGATATGAAACCACAGCTATATGTGCAGATGTAGCTGATGAGTTACAT
    GGGACACAAAGCTTATTCTGTTGGTTACATCTTATTGTTCCCATGACTACAATGATATGTGCATACAGAC
    ATGCACCACCAGAAACAAAAGGGGAGTATGACATAGACAAAATACAAGAGCAAAGCGGATTATACAGATA
    TCATATGGGAGGGATTGAAGGGTGGTGCCAGAAGTTATGGACAATGGAAGCAATATCCTTGTTAGATGTA
    GTATCTGTGAAGACTCGCTGTCAGATGACCTCTCTATTAAACGGAGACAATCAGTCAATAGATGTTAGTA
    AACCAGTAAAATTGTCTGAAGGTATAGATGAAGTAAAAGCAGACTATAGCTTAGCAATTAGAATGCTTAA
    AGAAATAAGAGATGCTTATAAAAACATTGGTCATAAACTCAAAGAAGGTGAAACATATATATCAAGGGAT
    CTCCAATTTATAAGTAAGGTGATTCAATCTGAAGGGGTCATGCATCCTACCCCTATAAAAAAGATATTAA
    GAGTAGGTCCTTGGATAAATACAATACTAGATGATATTAAAACCAGTGCAGAATCAATAGGGAGTCTATG
    TCAAGAACTAGAATTCAGAGGGGAGAGTATACTAGTTAGCTTGATATTAAGGAATTTCTGGCTGTATAAC
    TTGTACATGTATGAGTCAAAACAGCACCTGCTAGCTGGAAAGCAACTATTTAAGCAATTGAACAAAACAT
    TAACTTCTGTGCAGAGATTTTTTGAACTGAAGAAAGAAAATGACGTGGTTGACATATGGATGAATATACC
    AATGCAGTTTGGAGGGGGAGATCCGGTAGTTTTTTACAGATCTTTCTACAGAAGGACTCCCGATTTCCTA
    ACTGAAGCAATCAGCCATGTGGATTTACTGTTAAAAGTGTCAAACAATATCAAAGATGAGACTAAGGTAC
    GATTCTTCAAAGCCTTATTATCTATAGAAAAGAATGAACGTGCTACATTAACAACACTAATGAGAGACCC
    TCAGGCAGTAGGATCAGAACGACAAGCTAAGGTAACAAGTGATATAAATAGAACAGCAGTTACCAGCATA
    CTGAGTCTATCTCCGAACCAGCTCTTCTGTGATAGTGCTATACATTATAGTAGAAATGAGGAAGAAGTTG
    GGATCATTGCAGACAACATAACACCTGTCTATCCTCATGGGCTGAGAGTGCTCTATGAATCACTACCTTT
    TCATAAGGCTGAAAAGGTTGTCAATATGATATCAGGCACAAAGTCTATAACTAATCTATTACAGAGAACA
    TCTGCTATCAATGGTGAAGATATTGATAGAGCAGTGTCTATGATGTTAGAGAACTTAGGGTTGTTATCTA
    GGATATTGTCAGTAATAATTAATAGTATAGAAATACCAATCAAGCCCAATGGTAGATTGATATGCTGTCA
    AATTTCCAAGACCTTGAGAGAAAAATCATGGAACAATATGGAAATAGTAGGAGTGACATCTCCTAGTATT
    GTAACATGTATGGATGTTGTGTATGCAACTAGTTCTCATTTAAAAGGAATAATTATTGAAAAATTCAGTA
    CTGACAAGACCACAAGAGGTCAGAGGGGACCAAAAAGCCCCTGGGTAGGATCAAGCACTCAAGAGAAAAA
    ATTGGTTCCTGTTTATAATAGACAAATTCTTTCAAAACAACAAAAAGAGCAACTGGAAGCAATAGGAAAA
    ATGAGGTGGGTGTACAAAGGAACTCCAGGGCTAAGAAGATTGCTCAATAAGATTTGCATAGGAAGTTTAG
    GTATTAGCTATAAATGTGTAAAACCTTTATTACCAAGATTCATGAGTGTAAACTTCCTACATAGGTTATC
    TGTTAGTAGTAGACCCATGGAATTCCCAGCTTCTGTTCCAGCTTACAGGACAACAAATTACCATTTTGAC
    ACTAGTCCAATCAACCAAGCATTAAGTGAGAGGTTCGGGAACGAAGACATTAACCTAGTGTTCCAAAATG
    CAATCAGCTGCGGAATTAGTATAATGAGTGTTGTAGAACAGTTAACTGGTAGAAGCCCAAAACAATTAGT
    CCTAATCCCTCAATTAGAAGAGATAGATATTATGCCTCCTCCTGTATTTCAAGGAAAATTCAATTATAAA
    CTAGTTGATAAGATAACCTCCGATCAACACATCTTCAGTCCTGACAAAATAGACATATTAACACTAGGGA
    AGATGCTTATGCCTACCATAAAAGGTCAAAAAACTGATCAGTTCTTAAATAAGAGAGAAAACTATTTTCA
    TGGAAATAATTTGATTGAATCTTTATCTGCAGCACTTGCATGCCACTGGTGTGGGATATTAACAGAACAG
    TGTATAGAAAACAATATCTTTAGGAAAGATTGGGGTGATGGGTTCATCTCAGATCATGCCTTCATGGATT
    TCAAAGTATTTCTATGTGTATTTAAAGCCAAACTTTTATGTAGTTGGGGATCTCAAGGAAAGAATGTAAA
    AGATGAAGATATAATAGATGAATCCATTGATAAATTATTAAGAATTGACAACACCTTTTGGAGAATGTTC
    AGCAAAGTCATGTTTGAATCAAAAGTCAAAAAAAGAATAATGTTATATGATGTGAAATTCCTATCATTAG
    TAGGTTATATAGGATTTAAAAATTGGTTTATAGAACAGTTAAGAGTGGTGGAACTGCACGAGGTACCTTG
    GATTGTCAATGCTGAAGGAGAGTTAGTTGAAATTAAATCAATCAAAATTTATCTGCAGTTAATAGAACAA
    AGTCTATCTTTGAGAATAACTGTATTGAATTATACAGACATGGCACATGCTCTTACACGATTAATTAGGA
    AAAAATTGATGTGTGATAATGCACTCTTCAATCCAAGTTCATCACCAATGTTTAATCTAACACAGGTTAT
    TGATCCTACAACACAACCAGACTATTTTCCTAGGATAATATTTGAGAGGTTAAAAAGTTATGATACCAGT
    TCAGACTACAACAAAGGGAAGTTAACAAGGAATTACATGACATTATTACCATGGCAACACGTAAACAGGT
    ACAATTTTGTCTTTAGTTCTACAGGTTGTAAAATCAGTTTGAAGACATGCATCGGGAAATTGATAAAGGA
    TTTAAATCCTAAAGTTCTTTACTTTATTGGAGAAGGAGCAGGTAACTGGATGGCAAGAACAGCATGTGAA
    TATCCTGATATAAAATTTGTATATAGGAGTTTAAAGGATGACCTTGATCACCATTACCCATTAGAATATC
    AGAGGGTAATAGGTGATCTAAATAGGGTGATAGATAGTGGTGAAGGACTATCAATGGAAACCACAGATGC
    AACTCAAAAAACTCATTGGGACTTGATACACAGAATAAGTAAAGATGCTTTATTGATAACATTGTGTGAT
    GCAGAATTCAAAAACAGAGATGATTTCTTTAAGATGGTAATCCTTTGGAGAAAACATGTATTATCCTGTA
    GAATCTGTACAGCTTATGGAACAGATCTTTACTTATTTGCAAAGTATCATGCGGTGGACTGCAATATAAA
    ATTACCATTTTTTGTAAGATCTGTAGCTACTTTTATTATGCAAGGAAGCAAATTATCAGGGTCAGAATGT
    TACATACTTTTAACATTAGGTCATCACAATAATCTACCTTGTCATGGAGAAATACAAAATTCCAAAATGA
    GAATAGCAGTGTGTAATGATTTTTATGCCTCAAAGAAACTGGACAACAAATCAATTGAAGCAAACTGCAA
    ATCTCTTCTATCAGGATTGAGAATACCTATAAACAAAAAGGAATTAAATAGACAAAAGAAATTGTTAACA
    CTACAAAGTAACCATTCTTCTGTAGCAACAGTTGGCGGCAGTAAGATTATAGAATCCAAATGGTTAAAGA
    ATAAAGCAAGTACAATTATTGATTGGTTAGAGCATATTTTGAATTCTCCAAAAGGTGAATTAAACTATGA
    TTTCTTTGAAGCATTAGAGAACACATACCCCAATATGATCAAGCTTATAGATAATCTGGGAAATGCAGAA
    ATAAAGAAACTAATCAAGGTCATTGGGTATATGCTTGTGAGTAAGGAGTAATAATAATAATAATGATTAA
    CCATAATCTCACACAACTGAGAAAATAATCATCTAACAGTTTAGTTGATCATTAGTTAATTAAAAATTAT
    AAATTAGTAACTAACTGATAAAAAATCAGAAATTGAAATTGAATGTATACGGTTTTTTTGCCGT
  • Molecule Role : Other
3. Human parainfluenza virus 1 genome
  • Gene Name : Human parainfluenza virus 1 genome
  • Sequence Strain (Species/Organism) : Human parainfluenza virus 1
  • NCBI Nucleotide GI : 19718363
  • NCBI Protein GI : 19718364
  • Protein Accession : NP_604433.1
  • Taxonomy ID : 12730
  • Gene Strand (Orientation) : ?
  • Protein Name : nucleoprotein
  • Protein Note : nucleocapsid protein
  • DNA Sequence : Show Sequence
    >gi|19718363|ref|NC_003461.1| Human parainfluenza virus 1, complete genome
    ACCAAACAAGAGGAAAAACTTGTTTGGAATATATAATAATATTAAATAGTATTTTAGGGTTAAAGTAATA
    CTTTAAAGGGACAAGTCACAGACATTTGATCTTAGTATAAATTTTTATAATGGCCGGGCTACTAAGTACT
    TTTGACACATTTAGTTCCAGGAGAAGTGAGAGCATCAATAAGTCTGGCGGAGGAGCAATTATACCTGGTC
    AAAGAAGTACCGTTTCTGTCTTCACATTAGGCCCGAGTGTGACAGATGATGCAGATAAATTATTAATAGC
    AACCACTTTCTTAGCCCACTCATTGGACACAGATAAACAACACTCTCAAAGAGGAGGATTTTTAGTATCA
    CTCCTTGCAATGGCCTACAGTAGTCCGGAGTTATATCTCACTACAAACGGTGTCAATGCTGATGTCAAGT
    ATGTGATATACAATATAGAGAGAGATCCTAAAAGAACAAAAACAGATGGGTTCATTGTCAAAACAAGAGA
    CATGGAGTATGAAAGAACAACAGAGTGGTTGTTTGGACCTATGATCAACAAGAACCCATTGTTCCAAGGG
    CAAAGAGAGAATGCGGATCTAGAGGCATTGCTTCAGACATATGGATATCCTGCATGTCTCGGAGCTATAA
    TAGTTCAAGTTTGGATAGTGTTGGTTAAAGCCATAACAAGTAGTGCTGGTCTAAGAAAAGGATTCTTCAA
    TAGATTAGAAGCATTCAGACAGGATGGAACCGTTAAAAGTGCCCTGGTCTTCACAGGAGACACAGTTGAA
    GGTATTGGTGCAGTGATGAGGTCACAACAAAGCTTAGTATCTCTTATGGTAGAAACTCTGGTGACTATGA
    ACACATCCAGGTCAGATTTAACTACATTAGAGAAGAACATTCAGATTGTAGGAAATTACATAAGAGATGC
    AGGATTAGCATCTTTCATGAACACCATCAAGTATGGTGTAGAAACGAAGATGGCCGCCCTGACACTATCA
    AATCTGAGACCAGATATAAACAAATTGAGAAGCCTTGTTGATATCTATCTATCAAAGGGAGCCCGAGCCC
    CTTTTATATGTATACTCAGAGACCCAGTTCATGGAGACTTTGCCCCTGGAAACTATCCAGCACTGTGGAG
    CTACGCAATGGGCGTTGCTGTGGTACAAAACAAAGCTATGCAACAGTATGTAACTGGAAGAACATATTTG
    GACATGGAAATGTTCCTACTTGGACAAGCTGTAGCTAAAGATGCTGATTCCAAAATCAGCAGTGCTCTGG
    AGGAAGAACTAGGTGTGACAGATACAGCAAAAGAGAGACTAAGACACCATCTGACAAACCTTTCAGGAGG
    GGATGGTGCGTACCACAAGCCTACAGGTGGTGGAGCTATAGAAGTGGCAATTGATCATACAGACATAACA
    TTTGGAGTCGAGGACACTGCTGATCGGGACAACAAGAACTGGACAAATGACAGCAATGAAAGATGGATGA
    ATCACTCGATCAGCAACCACACAATCACGATTCGTGGTGCAGAAGAACTTGAAGAAGAGACAAATGATGA
    AGACATCACTGATATAGAAAACAAGATTGCACGAAGGCTGGCCGACAGAAAACAGAGACTAAGCCAGGCA
    AACAATAAACGAGACACCAGCAGTGATGCTGACTATGAGAATGATGATGATGCTACAGCGGCTGCAGGGA
    TAGGAGGAATTTAACAGGATACTTGGACAATAGAAGCCAGATCAAAAGTAAGAAAAACTTAGGGTGAATG
    ACAATTCACAGATCAGCTCAACCAGACACCACCAGCATACACGAAACCAACCTTCACAGTGGATACCTCA
    GCATCCAAAACTCTCCTTCCCGAATGGATCAGGATGCCTTCTTTTTTGAGAGGGATCCTGAAGCCGAAGG
    AGAGGCACCACGAAAACAAGAATCACTCTCAGATGTCATCGGACTCCTTGACGTCGTCTTATCCTACAAG
    CCCACAGAAATTGGAGAAGACAGAAGCTGGCTCCATGGTATCATCGACAACCCAAAAGAAAACAAGCCAT
    CATGCAAAGCCGACGATAACAACAAAGACAGAGCAATCTCAACGTCGACCCAAGATCATAGATCAAGTGA
    GGGGAGTGGAATCTCTAGGAGAACAAGTGAGTCAAAAACAGAGACACATGCTAGAATCCTTGATCAACAA
    GGTATACACAGGGCCTCTAGGCGAGGAACTAGTCCAAACCCTCTACCTGAGAATATGGGCAATGAAAGAA
    ACACCAGAATCGACGAAGATTCTCCAAATGAGAGAAGACATCAGAGATCAGTACTTACGGATGAAGACAG
    AAAGATGGCTGAGAACTCTAATAAGAGGGAAGAAGACCAAGTTGAGGGATTTCCAGAAGAGGTACGAAGA
    AGTACACCCTTATCTGATGATGGAGAGGGTAGAACAAATAATAATGGAAGAAGCATGGAAACTAGCAGCA
    CACATAGTACAAGAATAACTGATGTCATTACCAACCCAAGTCCAGAGCTTGAAGATGCCGTTCTACAAAG
    GAACAAAAGACGGCCGACGACCATCAAGCGTAACCAAACAAGATCAGAGAGAACACAGAGTTCAGAACTC
    CACAAATCAACAAGTGAAAATAGCTCCAACCTCGAAGACCACAACACCAAAACCAGCCCAAAAGTTCCAC
    CGTCAAAGAACGAAGAGTCAGCAGCCACTCCAAAGAACAACCACAACCACAGAAAAACAAGATACACAAC
    AAACAATGCAAACAACAACACAAAAAGTCCACCAACTCCCGAACACGACGCAACCGCAAATGAAGAGGAA
    ACCAGCAACACATCGGTCGATGAGATGGCCAAGTTATTAGTAAGTCTTGGTGTAATGAAATCACAACATG
    AATTTGAATTATCTAGGAGTGCAAGTCATGTATTTGCTAAGCGCATGTTAAAATCTGCAAATTACAAAGA
    AATGACATTTAATCTCTGTGGTATGCTTATATCAGTTGAAAAATCACTTGAGAATAAAGTAGAAGAAAAT
    AGAACATTACTTAAACAAATTCAAGAGGAAATAAATTCATCCAGGGATCTTCACAAACGGTTCTCGGAAT
    ACCAAAAAGAACAGAACTCACTCATGATGGCCAATCTATCCACACTCCATATAATTACAGATAGAGGCGG
    GAAAACGGGAAATCCCAGTGATACTACAAGGTCACCATCAGTCTTCACAAAAGGGAAAGACAATAAGGTC
    AAAAAGACAAGGTTTGACCCCTCTATGGAAGCTCTAGGAGGTCAAGAGTTCAAGCCTGACTTGATAAGAG
    AGGATGAACTGAGAGATGACATCAAAAATCCGGTACTAGAAGAAAACAACAATGAGCCTCAAGCATCCAA
    TGCATCACGCCTGATTCCGTCCACTGAAAAACACACTCTGCACTCACTCAAACTAGTTATCGAAAACAGT
    CCTCTAAGCAGAGTAGAGAAGAAGGCTTACATCAAATCCCTTTATAAGTGTCGGACAAACCAAGAGGTTA
    AAAATGTAATGGAGCTATTCGAGGAAGACATAGATTCACTAACTAACTAAACATGAATCTACAATTTCAA
    CCAGCAATCAAAATCAATATCCAGAGCCAACTCAAAAAGCTCCCTCAAAACAATTAAGAAAAACTTAGGG
    TCAAAGAAATTTTGCCCGGAGAAAGGAAATGGCTGAAACATACAGGTTCCCCAGATTCTCACACGAAGAA
    AATGGGACAGTAGAACCTCTCCCTCTCAAAACAGGTCCTGACAAAAAAGCAATCCCTCACATCAGAATAG
    TCAAGGTAGGAGATCCTCCAAAACATGGAGTCAGGTATCTTGATGTGCTACTATTGGGATTCTTTGAAAC
    ACCTAAGCAAGGACCTCTATCTGGCAGCATATCTGATCTCACAGAATCAACCAGTTATTCAATCTGTGGA
    TCCGGATCCTTACCAATTGGCATAGCCAAGTATTACGGCACAGATCAAGAATTATTAAAAGCCTGCATTG
    ACCTCAAAATAACTGTACGAAGAACAGTTAGATCTGGAGAAATGATAGTATACATGGTAGATTCGATCCA
    TGCTCCTCTACTACCATGGTCCAGCCGACTGAGACAAGGGATGATATATAATGCCAATAAAGTAGCTCTA
    GCACCTCAATGTCTCCCAGTCGACAAAGACATCAGATTCAGGGTTGTATTTGTCAATGGAACATCACTAG
    GTACAATTACAATTGCTAAGGTCCCAAAAACTCTTGCAGATCTTGCATTACCGAACTCAATATCAGTGAA
    TCTGCTGGTTACACTTAGGGCAGGAGTATCAACGGAACAAAAAGGAATCCTCCCCGTTCTAGACGATGAT
    GGAGAAAAGAAGCTCAACTTCATGGTACACCTAGGAATCATAAGAAGAAAAGTTGGGAAGATATATTCAG
    TTGAATACTGCAAAAATAAAATTGAGAAGATGAAGCTAATATTCTCTCTCGGGCTTGTAGGTGGAATAAG
    TTTCCATGTACATGCAACAGGCACATTATCCAAAACTCTAATGAGCCAACTTGCATGGAAAAAAGCAGTT
    TGCTATCCTTTAATGGATGTAAATCCACATATGAATCTAGTCATCTGGGCAGCTTCAGTAGAAATCACAA
    GTGTCGATGCTGTGTTCCAACCTGCAATTCCGAAAGAATTTCGCTATTACCCAAATGTTGTTGCAAAAAG
    CATCGGGAAAATCAGGAGGATATAAGTCTACACTCCTCAATAATGACACCCATTAGCTCTAAATCGTACC
    ATTAATCAAATACAGATCAATTCGATACAATCAGTTCAAATAAGAAAAACGTAGGGACAAAGTCCTCTAC
    CAACATCAAGGAAGACAAGAGTCTCAAAAAGCTCAGCCTAAGCAGAGAGAAAAACAACAACACAAAGAAA
    GAAAAGGACAAGATCACAAACAAGAACAAAAGCAAAAACAAAAACAAGAACAAAAAAGGGAAGAAAAACA
    AAAGTATACACAAAAACCAAAAAAGAAAAAAGGCCAGAGACAAAAACGGAGGCAAGAACAAAAATTTAAA
    CAAAAACAGAATTTAAATTCATAATAAACACCAAGATAGAGACAAAAATGCAAAAATCAGAGATCCTCTT
    CTTAGTATACTCAAGCTTGCTATTATCTTCATCATTATGTCAAATTCCGGTAGAAAAACTTTCAAATGTA
    GGGGTTATAATCAATGAGGGCAAATTACTTAAAATAGCAGGATCTTATGAATCTAGATACATAGTGTTAA
    GCTTGGTACCTTCAATTGACCTACAAGATGGATGTGGAACAACTCAAATTATTCAATACAAGAATTTATT
    AAATAGACTTCTAATTCCTCTGAAGGATGCCTTGGATCTTCAGGAATCCCTGATAACAATAACTAATGAC
    ACCACTGTGACAAATGATAATCCACAAACTAGATTCTTTGGTGCTGTCATTGGTACCATAGCACTAGGAG
    TAGCCACAGCTGCTCAAATAACTGCGGGCATTGCATTAGCTGAAGCACGAGAAGCCAGGAAGGACATAGC
    ACTAATAAAAGATTCCATAGTCAAGACACACAATTCTGTAGAACTCATTCAAAGAGGTATAGGAGAACAG
    ATAATTGCATTAAAGACATTACAAGATTTTGTAAATGACGAGATAAGACCTGCAATAGGAGAACTAAGGT
    GTGAGACTACGGCATTGAAACTAGGGATCAAGCTCACCCAACACTACTCTGAATTAGCAACAGCATTCAG
    CTCCAATCTTGGGACTATAGGAGAAAAAAGTCTTACCTTGCAGGCATTATCATCTCTCTACTCTGCTAAT
    ATAACAGAAATTCTAAGTACAACTAAAAAGGATAAATCAGATATATATGACATCATTTACACTGAACAGG
    TTAAGGGAACTGTGATAGATGTTGATTTGGAAAAATACATGGTTACCCTCTTAGTTAAAATACCAATTTT
    ATCAGAAATACCAGGCGTGTTGATATACAGAGCTTCATCTATATCTTATAATATTGAAGGAGAAGAATGG
    CATGTCGCAATCCCAAATTACATAATCAATAAGGCATCATCCTTAGGAGGTGCAGATGTCACAAACTGTA
    TAGAATCAAAATTGGCATATATATGTCCTAGAGATCCTACACAATTAATACCTGATAACCAACAGAAGTG
    TATACTCGGGGATGTATCAAAGTGCCCTGTGACTAAAGTAATAAACAATCTAGTACCAAAGTTCGCATTC
    ATCAATGGTGGTGTAGTGGCTAATTGCATTGCATCCACATGTACATGCGGGACAAACAGAATACCAGTGA
    ATCAAGATCGCTCAAGAGGAGTTACATTCTTGACCTATACCAATTGCGGTTTAATAGGTATAAATGGAAT
    AGAACTATATGCCAATAAAAGGGGACGAGACACTACTTGGGGGAATCAAATCATCAAAGTGGGTCCAGCA
    GTCTCCATTAGACCTGTAGACATTTCTTTAAATCTTGCATCTGCCACAAATTTCCTAGAGGAATCCAAGA
    CAGAGCTCATGAAGGCAAGGGCAATCATATCAGCAGTTGGAGGATGGCACAACACAGAGAGTACTCAGAT
    AATCATGATAATAATTGTGTGCATACTTATAATAATCATATGTGGTATATTATACTATCTATACAGGGTT
    AGAAGACTATTAGTAATGATTAATTCAACTCATAATTCACCTGTTAATGCTTATACTCTGGAGTCAAGAA
    TGAGAAATCCCTACATGGGTAACAACTCCAATTAAAAAATCAGATCAAGTACATTGTAGCATACATACAA
    CAATCAAATCTATCCACAACTTCACCAATCAGGTGTACAACAAGTAAGAAAAACTTAGGGTTAAAGACAA
    TCCAGTCAACCTATAAGGCAACAGCATCCGATTATACAAACGATGGCTGAAAAAGGGAAAACAAATAGTT
    CATATTGGTCTACAACCCGAAATGACAATTCCACGGTAAACACACACATTAATACACCAGCAGGAAGGAC
    ACACATCTGGCTACTGATTGCAACAACAATGCATACAGTATTGTCCTTCATTATCATGATCCTATGCATT
    GACCTAATTATAAAACAAGACACTTGTATGAAGACAAACATCATGACAGTATCCTCCATGAACGAAAGTG
    CCAAAATAATCAAAGAGACAATCACAGAATTAATCAGACAAGAAGTAATATCAAGGACCATAAACATACA
    AAGTTCAGTACAAAGCGGGATCCCAATATTGTTAAACAAGCAAAGCAGAGATCTCACACAATTAATAGAG
    AAGTCATGCAACAGACAGGAATTGGCTCAGATATGCGAAAACACCATTGCTATTCACCATGCAGACGGCA
    TATCTCCTCTGGACCCACACGATTTCTGGAGATGTCCCGTAGGGGAACCCCTACTGAGCAACAACCCCAA
    TATCTCATTATTACCTGGACCAAGTCTACTTTCTGGATCCACCACAATTTCAGGATGTGTTAGACTACCT
    TCATTATCAATTGGTGATGCAATATATGCGTATTCATCAAACTTAATCACTCAAGGATGTGCAGATATAG
    GGAAGTCATATCAGGTTTTACAATTAGGTTACATATCCTTAAATTCAGATATGTATCCTGATTTAAACCC
    GGTAATTTCTCATACCTATGACATCAACGACAACAGGAAATCATGTTCTGTAATAGCTGCAGGAACAAGG
    GGTTATCAGTTATGCTCCTTGCCCACTGTGAATGAGACTACAGACTACTCGAGTGAAGGTATAGAAGATT
    TAGTATTTGACATATTAGATCTCAAGGGAAAGACCAAATCTCATCGATACAAAAATGAAGATATAACTTT
    TGACCATCCTTTTTCTGCAATGTATCCGAGTGTAGGAAGTGGGATAAAAATTGAAAATACACTCATTTTC
    CTAGGGTACGGTGGCTTAACAACTCCGCTCCAAGGCGACACTAAGTGTGTGATAAACAGATGTACCAATG
    TTAATCAGAGTGTTTGCAATGATGCTCTTAAGATAACTTGGCTAAAGAAAAGACAAGTTGTCAATGTCTT
    AATTCGTATCAATAATTATTTATCTGATAGGCCAAAGATTGTTGTCGAGACAATTCCAATAACTCAAAAT
    TACTTAGGTGCCGAAGGTAGGCTACTTAAACTAGGTAAAAAGATCTACATATATACTAGATCTTCAGGTT
    GGCACTCCAACCTGCAAATAGGATCATTAGATATCAACAACCCCATGACCATTAAATGGGCGCCTCATGA
    AGTCCTGTCTCGACCAGGAAACCAAGACTGCAACTGGTACAACAGATGTCCGAGAGAATGCATATCAGGT
    GTATATACTGATGCATATCCACTATCTCCTGATGCAGTCAATGTTGCTACAACCACACTGTACGCAAACA
    CATCACGTGTTAATCCCACCATAATGTACTCAAATACCTCAGAAATTATCAACATGCTAAGACTCAAGAA
    TGTACAACTAGAGGCAGCATACACTACTACATCATGTATCACTCATTTCGGGAAGGGCTACTGCTTCCAC
    ATTGTTGAAATCAACCAAGCCAGCCTTAATACCTTACAACCTATGTTGTTCAAGACAAGTATCCCTAAAA
    TATGTAAAATCACATCTTGAGCAGATCAAGACCCAACACTATATCAATTATGTGAAAACCAGATATGATG
    TATAAAAATTTAAAAACAAAGCATGAATAGACATTTATATGACAAATAGAATAAGAAAAACTTAGGGTTA
    ATGCCTGCCTATTTGTCAAATATGGATAAACAGGAGTCAACTCAGAATTCCTCAGACATCTTATATCCAG
    AATGTCACTTGAACTCTCCGATTGTAAAAAGCAAGATTGCTCAACTTCACGTTTTGCTAGATATCAATCA
    ACCCTATGATTTAAAAGATAACAGTATAATAAATATCACCAAATACAAAATCAGAAATGGAGGTTTATCG
    CCCCGGCAGATCAAAATCAGATCGCTAGGCAAAATCCTTAAACAAGAAATTAAGGATATTGATCGTTACA
    CTTTTGAACCTTATCCGATTTTCTCATTAGAGTTACTCAGACTGGATATCCCAGAAATATGTGACAAAAT
    AAGATCCATTTTTTCAGTCTCTGATAGATTAATAAGAGAACTATCATCTGGATTTCAAGAATTGTGGTTA
    AATATTCTTAGACAATTAGGCTGTGTTGAAGGGAAAGAGGGATTTGACTCATTAAAGGATGTAGATATCA
    TCCCAGATATAACTGATAAATATAATAAAAACACATGGTATCGCCCATTCTTAACATGGTTTAGCATCAA
    ATATGATATGAGATGGATGCAAAAGAATAAGTCGGGGAACCATTTAGATGTCTCAAATTCTCACAATTTT
    CTTGACTGTAAATCATATATTTTGATTATATATAGAGATTTAGTGATAATAATAAATAAATTAAAATTAA
    CCGGTTATGTCCTTACACCTGAATTAGTATTAATGTATTGTGATGTTGTCGAAGGAAGATGGAATATGTC
    TTCAGCTGGACGACTCGATAAAAGGTCATCAAAAATAACATGTAAGGGGGAAGAATTATGGGAGCTTATC
    GACTCTTTATTTCCCAATCTTGGTGAGGATGTATATAATATTATATCACTACTAGAACCTTTATCACTTG
    CTTTAATACAGTTGGATGACCCTGTAACTAATTTAAAAGGAGCTTTCATGAGACATGTTTTGACTGAGCT
    ACATACAATTTTAATAAAAGATAATATATACACAGATTCAGAAGCAGACAGCATAATGGAATCATTGATA
    AAGATTTTCAGAGAGACATCAATTGATGAAAAAGCAGAAATTTTCTCCTTTTTTAGAACGTTTGGACATC
    CTAGCTTAGAAGCAATAACTGCTGCCGATAAAGTAAGGACACATATGTATTCCTCCAAAAAAATCATACT
    AAAGACACTATATGAGTGTCATGCAATCTTCTGTGCAATTATAATAAACGGATATAGAGAAAGACACGGT
    GGTCAATGGCCGCCATGCGAATTCCCCAATCATGTATGTCTTGAACTCAAGAATGCACAAGGATCCAACT
    CTGCAATTTCGTATGAATGTGCCGTAGACAATTATAGTAGTTTTATAGGATTTAAATTTTTAAAATTTAT
    TGAGCCTCAATTAGATGAAGATTTGACAATTTATATGAAGGATAAGGCTCTATCACCTAGGAAAGCAGCA
    TGGGATTCAGTATATCCCGACAGTAATTTATATTACAAAGTCCCTGAATCAGAAGAGACTCGTAGGTTAA
    TCGAGGTTTTTATAAATGATAATAATTTTAACCCTGCGGATATTATTAATTATGTAGAGTCAGGAGAATG
    GTTAAATGACGATAGCTTCAACATATCTTACAGTCTCAAAGAAAAAGAAATTAAACAAGAGGGTCGACTC
    TTTGCCAAGATGACATATAAGATGAGAGCAGTCCAGGTATTAGCAGAAACACTACTAGCAAAAGGAGTAG
    GTGAGTTATTCAGTGAAAATGGGATGGTAAAGGGAGAAATTGACCTACTAAAGAGACTGACTACATTATC
    TGTCTCAGGTGTTCCAAGATCCAACTCAGTTTACAATAATCCCATATTACATGAGAAATTGATCAAAAAT
    ATGAATAAGTGCAATTCAAATGGGTATTGGGATGAAAGAAAGAAATCTAAAAATGAATTCAAAGCTGCAG
    ACTCATCAACCGAGGGGTATGAGACTCTGAGCTGTTTTTTAACCACCGATTTGAAAAAATACTGTCTCAA
    CTGGAGATTTGAAAGTACAGCGTTGTTCGGTCAAAGATGTAATGAGATATTCGGGTTTAAAACTTTCTTT
    AACTGGATGCACCCTATTCTAGAAAAAAGTACAATTTATGTAGGAGATCCTTACTGTCCAGTACCTGATA
    GAATGCACAAAGAACTCCAAGATCATGATGATACCGGAATCTTTATCCATAATCCAAGAGGGGGAATAGA
    GGGTTATTGCCAGAAATTATGGACACTAATCTCTATTAGTGCAATCCATCTTGCAGCTGTTAAAGTTGGT
    GTCAGAGTGTCAGCAATGGTACAAGGAGACAATCAAGCTATAGCAGTGACATCCAGAGTTCCTGTCACAC
    AAACCTATAAGCAAAAAAAGACTCACGTCTATGAAGAAATCACAAGATATTTCGGTGCCTTGAGAGAAGT
    TATGTTTGATATTGGACATGAATTAAAATTAAATGAGACCATTATAAGTAGCAAAATGTTTGTATACAGC
    AAACGGATATATTATGATGGGAAAATCCTCCCACAGTGCCTCAAAGCTTTAACAAGATGTGTATTTTGGT
    CAGAGACTCTTGTAGATGAAAACAGGTCAGCATGCTCAAACATTGCAACATCTATAGCCAAAGCTATTGA
    GAATGGATATTCACCTATCTTAGGCTATTGTATTGCTCTTTTTAAAACTTGCCAACAGGTATGTATATCA
    TTAGGAATGACCATTAATCCTACTATTACGTCAACTATCAAAGATCAATATTTTAAAGGGAAAAATTGGT
    TAAGATGTGCAATATTGATCCCAGCTAACATAGGAGGGTTCAACTATATGTCTACAGCTAGATGTTTTGT
    CAGAAATATAGGTGATCCAGCAGTTGCAGCTCTAGCAGACTTAAAGAGATTCATCAAAGCAGGTCTGTTA
    GATAAACAGGTATTATATCGTGTGATGAATCAAGAACCAGGAGACTCAAGCTTCTTAGATTGGGCATCAG
    ACCCTTATTCATGCAATCTCCCACACTCACAAAGTATAACAACTATAATCAAAAATGTAACAGCTAGATC
    AGTATTGCAGGAATCACCTAATCCTCTCCTATCAGGTCTCTTTTCAGAATCAAGTAGTGAAGAAGATCTC
    AACTTAGCATCATTTTTGATGGATAGGAAAGCCATATTGCCCAGAGTAGCTCACGAGATCTTAGATAACT
    CACTTACAGGTGTAAGAGAAGCTATAGCCGGGATGCTTGATACAACGAAATCTCTAGTAAGAGCTAGTGT
    CAGGAGAGGAGGATTATCATATAGTATCTTAAGAAGACTTATAAATTATGATCTATTACAATATGAGACC
    TTAACAAGGACACTCAGAAAACCGGTTAAGGATAATATAGAATATGAGTATATGTGTTCAGTAGAATTGG
    CAATAGGATTGAGGCAAAAAATGTGGTTTCATCTAACTTATGGAAGACCAATCCACGGTTTAGAAACTCC
    AGACCCGTTAGAATTATTAAGAGGATCATTTATTGAAGGCTCAGAAATATGTAAATTTTGTAGATCAGAA
    GGGAATAACCCTATGTATACTTGGTTCTATCTTCCTGACAACATCGACTTAGATACACTTAGCAATGGAA
    GTCCTGCCATACGTATCCCTTATTTTGGTTCTGCTACTGATGAAAGATCAGAGGCTCAACTAGGTTATGT
    TAAGAACTTAAGCAAGCCGGCAAAAGCAGCAATAAGAATCGCAATGGTTTACACTTGGGCTTATGGAACT
    GATGAAATATCATGGATGGAAGCAGCACTTATAGCTCAAACCAGGGCTAACTTAAGTTTAGAGAATTTGA
    AGTTACTCACCCCTGTATCGACTTCTACAAATTTGTCCCACAGATTGAGAGATACTGCTACACAGATGAA
    ATTTTCAAGTGCTACTTTAGTTCGAGCGAGTCGATTTATTACCATATCTAATGATAATATGGCATTAAAA
    GAGGCAGGAGAGTCTAAAGATACTAATTTAGTTTATCAACAAATTATGTTAACCGGATTGAGCTTATTTG
    AATTCAATATGAGGTATAAACAAGGATCATTATCTAAACCTATGATATTACACTTACATTTGAATAATAA
    ATGCTGTATCATAGAATCTCCTCAAGAATTGAATATTCCTCCTAGATCTACATTGGACTTAGAGATCACT
    CAGGAAAATAACAAGTTAATCTATGATCCTGATCCTCTCAAGGACATAGATCTAGAGTTATTTAGTAAGG
    TTAGGGATGTAGTACACACAATTGATATGAATTATTGGTCTGATGATGAAATAATTAGAGCAACTAGTAT
    ATGTACAGCTATGACTATTGCAGACACAATGTCTCAATTAGATAGAGACAATCTTAAAGAAATGATAGCA
    CTGATAAATGATGATGATATAAATAGTTTAATCACCGAATTTATGGTTATTGATATACCCTTATTTTGTT
    CCACTTTCGGGGGTATTCTAATCAATCAATTTGCATATTCACTTTACGGGTTAAACGTCAGAGGGAGGGA
    TGAAATATGGGGATATGTGATACGCATAATTAAAGACACATCACATGCAGTCCTAAAAGTACTGTCCAAT
    GCATTATCACATCCTAAAATATTCAAACGATTCTGGGATGCAGGAGTTGTAGAGCCTGTTTATGGACCTA
    ACTTGTCCAATCAAGACAAGATACTGTTAGCCATTTCAGTATGTGAATACTCTGTTGACCTCTTCATGCG
    TGATTGGCAAGAGGGCATACCGCTTGAAATATTTATTTGTGATAACGACCCAAATATAGCAGAAATGAGA
    AAACTTTCATTTTTAGCTAGACATCTAGCATACTTGTGTAGTTTGGCAGAGATAGCTAAAGAGGGACCAA
    AATTGGAATCTATGACATCTCTCGAACGACTCGAATCATTGAAAGAGTATCTAGAACTTACTTTTTTAGA
    CGATCCTATATTAAGATATAGTCAATTGACAGGCTTAGTTATTAAGATATTCCCTTCAACGTTAACTTAC
    ATCAGGAAATCTTCAATTAAGGTGTTGAGAGTAAGAGGTATAGGGATACCAGAAGTCTTAGAGGACTGGG
    ATCCTGATGCCGATAGTATGCTACTAGATAATATAACTGCTGAGGTTCAACACAATATACCTTTAAAGAA
    GAACGAAAGAACTCCCTTCTGGGGGTTAAGGGTATCAAAATCACAAGTTCTGCGACTTAGAGGTTATGAA
    GAGATAAAAAGGGAAGAAAGAGGAAGATCAGGTGTAGGATTAACTCTACCTTTTGATGGGCGATATTTAT
    CACACCAATTGAGACTTTTCGGGATTAATAGCACCAGTTGTTTGAAAGCATTGGAACTTACCTATTTACT
    GAATCCTCTAGTCAATAAGGATAAAGATAGATTATATCTCGGAGAAGGTGCAGGTGCAATGCTGTCTTGT
    TATGATGCTACATTAGGACCCTGCATGAACTATTATAATTCAGGTGTTAATTCTTGTGATCTCAACGGAC
    AAAGAGAATTAAATATTTATCCTTCAGAAGTGGCACTGGTAGGGAAGAAATTGAATAATGTCACGAGTTT
    ATGTCAAAGAGTTAAGGTTTTATTCAATGGGAATCCTGGATCAACTTGGATAGGGAATGATGAATGTGAA
    ACACTAATCTGGAATGAATTACAGAATAATTCAATAGGGTTTATTCATTGTGACATGGAAGGTGGAGAAC
    ACAAATGTGATCAGGTGGTCTTACATGAACATTATAGTGTGATCAGGATTGCATACCTTGTTGGGGATAA
    GGACGTTATCTTAGTAAGCAAAATTGCACCAAGATTAGGTACAGACTGGACAAAACAATTAAGTTTGTAT
    TTAAGATACTGGAGAGATGTCAGCTTAATAGTGTTGAAAACATCTAACCCAGCCTCTACAGAAATGTATC
    TGATATCAAAAGATCCTAAATCTGATATTATAGAGGATAGTAATACAGTATTGGCAAACCTTCTTCCATT
    ATCTAAAGAGGATAGTATTAAGATAGAAAAATGGATTCTAGTTGAGAAAGCCAAAGTTCATGATTGGATA
    GTTAGAGAATTAAAGGAAGGGAGTGCATCGTCAGGTATGCTAAGACCTTACCATCAAGCATTACAAATCT
    TCGGATTTGAGCCTAATTTAAACAAATTATGTAGAGATTTCTTATCTACACTAAATATAGTAGACACAAA
    AAATTGTATTATCACATTTGATAGAGTATTAAGAGATACAATCTTTGAGTGGACTCGGATAAAAGACGCA
    GATAAGAAGCTAAGACTTACAGGTAAATATGATCTATATCCTCTTAGAGATTCAGGTAAGTTAAAAGTTA
    TTTCTAGAAGGCTTGTAATATCTTGGATAGCATTGTCTATGTCTACAAGACTAGTAACAGGGTCATTTCC
    AGACATTAAATTTGAATCAAGACTCCAATTAGGTATAGTATCAATATCCTCTCGTGAAATCAAAAATCTT
    AGGGTTATATCAAAGATTGTCATTGACAAATTTGAAGATATTATACATAGTGTGACCTATAGGTTCTTGA
    CTAAAGAAATAAAAATATTGATGAAAATTTTGGGAGCAGTCAAATTATTTGGGGCAAGACAGAGCACATC
    TGCTGATATCACTAATATCGATACATCGGACTCCATACAATGATCTTATATCTTCTCATCTTTATTATCT
    AATTTGTTTAAAGAGATGAGTTAACAAGATAAGAAATCCCTTTAACTGACTCATAAAAACATAGTAAGAA
    AAACTTACAACAGACAAGAGTATTAATAATATATCGATATTTCTTAAACTCTTGTCTGGT
  • Molecule Role : Other
III. Vaccine Information
IV. References
1. CDC - Human Parainfluenza Viruses: Human Parainfluenza Viruses [http://www.cdc.gov/parainfluenza/about/overview.html]
2. Kobayashi et al., 2013: Kobayashi H, Iwatsuki-Horimoto K, Kiso M, Uraki R, Ichiko Y, Takimoto T, Kawaoka Y. A replication-incompetent influenza virus bearing the HN glycoprotein of human parainfluenza virus as a bivalent vaccine. Vaccine. 2013; 31(52); 6239-6246. [PubMed: 24144478].