VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Viral haemorrhagic septicaemia virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Introduction
  2. Vaccine Related Pathogen Genes
    1. Glycoprotein (Protective antigen)
    2. nucleocapsid (Protective antigen)
  3. Vaccine Information
    1. VHSV DNA vaccine pCMV-vhsG encoding glycoprotein G
    2. VHSV DNA vaccine pCMV-vhsN encoding nucleocapsid protein N and glycoprotein G
    3. VHSV DNA vaccine pVHS-G encoding glycoproteins
  4. References
I. General Information
1. NCBI Taxonomy ID:
11287
2. Introduction
Viral Hemorrhagic Septicemia (VHS) is a deadly fish virus and aquatic invasive species that attacks and weakens the blood vessels of fish. Broken blood vessels and severe blood loss ultimately causes death. It afflicts more than 50 species of freshwater and marine fish in several parts of the northern hemisphere. Scientists are not sure how the virus arrived. It may have come in with migrating fish, or may have hitchhiked in ballast water from ships. VHS was first found in European freshwater trout in the late 1930s and continues to cause epidemics in European trout farms. It appeared on the U.S. West Coast in 1988 in marine trout and salmon (WISC - VHSV).
1. Glycoprotein
  • Gene Name : Glycoprotein
  • Sequence Strain (Species/Organism) : Viral hemorrhagic septicemia virus Danish isolate DK-3592B
  • NCBI Protein GI : 299444
  • Genbank Accession : Y18263
  • Protein Accession : NP_049548
  • Other Database IDs : CDD:110007
  • Taxonomy ID : 11287
  • Gene Starting Position : 2958
  • Gene Ending Position : 4532
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein
  • Protein pI : 7.22
  • Protein Weight : 53143.93
  • Protein Length : 507
  • Protein Note : G protein
  • DNA Sequence : Show Sequence
    >gi|9632550:2958-4532 Viral hemorrhagic septicemia virus Fil3, complete genome
    CATGGAATGGAACACTTTTTTCTTGGTCATCTTGATCATCATCATAAAGAGCACCACACCACAGATCACT
    CAACGACCTCCGGTCGAAAACATCTCGACGTACCATGCAGATTGGGACACTCCGCTATACACTCATCCCT
    CCAACTGCAGGGACGATTCCTTTGTCCCGATTCGACCAGCTCAACTCAGGTGTCCTCATGAATTTGAAGA
    CATAAACAAGGGACTGGTCTCCGTCCCAACCAAGATCATCCATCTCCCGCTATCAGTCACCAGCGTCTCC
    GCAGTCGCGAGTGGCCACTACCTGCACAGAGTGACTTATCGAGTCACCTGTTCGACCAGCTTCTTTGGAG
    GGCAAACCATTGAAAAGACCATCTTAGAGGCGAAACTGTCTCGTCAGGAGGCCACAGACGAGGCAAGCAA
    GGATCACGAGTACCCGTTCTTCCCTGAACCCTCCTGCATCTGGATGAAAAACAATGTCCATAAGGACATA
    ACTCACTATTACAAGACCCCAAAAACAGTATCGGTGGATCTCTACAGCAGGAAATTTCTCAACCCTGATT
    TCATAGAGGGGGTTTGCACAACCTCGCCCTGTCAAACTCATTGGCAGGGAGTCTATTGGGTCGGTGCCAC
    ACCCAAAGCCCATTGCCCCACGTCGGAAACACTAGAAGGACACCTGTTCACCAGGACCCATGATCACAGG
    GTGGTCAAGGCAATTGTGGCAGGCCATCATCCCTGGGGACTCACAATGGCATGCACAGTGACATTCTGCG
    GGGCAGAATGGATCAAGACTGACCTGGGAGACCTGATCCAGGTAACAGGACCGGGGGGCACGGGGAAACT
    GACTCCAAAGAAGTGTGTCAATGCTGATGTCCAGATGAGGGGGGCAACAGATGACTTTTCTTATCTCAAC
    CATCTCATCACCAACATGGCTCAAAGAACCGAGTGCCTAGATGCCCATAGTGATATCACCGCTTCTGGGA
    AAATATCCTCATTTCTCCTCTCAAAGTTTCGTCCCAGCCACCCTGGACCCGGCAAGGCACACTATCTTCT
    CAACGGTCAAATCATGCGAGGTGACTGTGACTATGAGGCAGTAGTCAGCATCAACTACAACAGCGCTCAA
    TACAAGACAGTGAACAACACATGGAAATCATGGAAACGGGTAGACAACAACACAGACGGGTACGATGGGA
    TGATATTTGGGGACAAATTGATCATCCCGGACATCGAGAAGTATCAGAGTGTCTATGACAGTGGAATGCT
    CGTTCAAAGAAACCTTGTGGAAGTCCCTCATCTGAGCATTGTGTTTGTCTCCAACACATCTGATCTTTCC
    ACTAATCACATCCACACCAACCTAATCCCTTCGGATTGGTCATTCCACTGGAGTATTTGGCCCTCATTAT
    CTGGGATGGGGGTTGTGGGAGGGGCCTTCCTTCTACTGGTACTCTGCTGTTGCTGCAAGGCGTCCCCTCC
    CATTCCAAATTACGGGATTCCGATGCAGCAGTTCTCCAGAAGTCAGACGGTCTGAGCACACCTGTCCGAA
    TGACCACAATTCCTCTATTAGGTAGATAGAAAAAA
  • Protein Sequence : Show Sequence
    >gi|299444|gb|AAB26115.1| envelope glycoprotein, G protein [viral haemorrhagic septicaemia virus VHSV, Danish isolate DK-3592B, Peptide, 507 aa]
    MEWNTFFLVILIIIIKSTTPQITQRPPVENISTYHADWDTPLYTHPSNCRDDSFVPIRPAQLRCPHEFED
    INKGLVSVPTKIIHLPLSVTSVSAVASGHYLHRVTYRVTCSTSFFGGQTIEKTILEAKLSRQEATDEASK
    DHEYPFFPEPSCIWMKNNVHKDITHYYKTPKTVSVDLYSRKFLNPDFIEGVCTTSPCQTHWQGVYWVGAT
    PKAHCPTSETLEGHLFTRTHDHRVVKAIVAGHHPWGLTMACTVTFCGAEWIKTDLGDLIQVTGPGGTGKL
    TPKKCVNADVQMRGATDDFSYLNHLITNMAQRTECLDAHSDITASGKISSFLLSKFRPSHPGPGKAHYLL
    NGQIMRGDCDYEAVVSINYNSAQYKTVNNTWKSWKRVDNNTDGYDGMIFGDKLIIPDIEKYQSVYDSGML
    VQRNLVEVPHLSTVFVSNTSDLSTNHIHTNLIPSDWSFHWSIWPSLSGMGVVGGAFLLLVLCCCCKASPP
    IPNYGIPMQQFSRSQTV
  • Molecule Role : Protective antigen
  • Related Vaccine(s): VHSV DNA vaccine pCMV-vhsG encoding glycoprotein G , VHSV DNA vaccine pCMV-vhsN encoding nucleocapsid protein N and glycoprotein G , VHSV DNA vaccine pVHS-G encoding glycoproteins
2. nucleocapsid
  • Gene Name : nucleocapsid
  • Sequence Strain (Species/Organism) : Viral hemorrhagic septicemia virus DK-3592B
  • NCBI Protein GI : 3282333
  • Other Database IDs : CDD:112048
  • Taxonomy ID : 11287
  • Gene Strand (Orientation) : ?
  • Protein Name : nucleocapsid protein
  • Protein Length : 404
  • Protein Note : N protein
  • Protein Sequence : Show Sequence
    >gi|3282333|gb|AAC24962.1| nucleocapsid protein [Viral hemorrhagic septicemia virus]
    MEGGIRAAFSGLNDVRIDPTGGEGRVLVPGDVELIVYVGGFGEEDRKVIVDALSALGGPQTVQALSVLLS
    YVLQGNTQEDLETKCKVLTDMGFKVTQAVRATSIEAGIMMPMRELALTVNDDNLMEIVKGTLMTCSLLTK
    YSVDKMIKYITKKLGELADTQGVGELQHFTADKAAIRKLAGCVRPGQKITKALYAFILTEIADPTTQSRA
    RAMGALRLNGTGMTMIGLFTQAANNLGIAPAKLLEDLCMESLVESARRIIQLMRQVSEAKSIQERYAIMM
    SRMLGESYYKSYGLNDNSKISYILSQISGKYAVDSLEGLEGIKVTEKFREFAELVAEVLVDKYERIGEDS
    TEVSDVIKEAARQHARRTSAKPEPKARNFRSSTGRGKEQETGESDDDDYPEDSD
  • Molecule Role : Protective antigen
  • Related Vaccine(s): VHSV DNA vaccine pCMV-vhsN encoding nucleocapsid protein N and glycoprotein G
III. Vaccine Information
1. VHSV DNA vaccine pCMV-vhsG encoding glycoprotein G
a. Vaccine Ontology ID:
VO_0004338
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Zebra fish
e. Gene Engineering of Glycoprotein
  • Type: DNA vaccine construction
  • Description: Vector pcDNA3 expressed glycoprotein G gene of the virus (Heppel et al., 1997).
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3 (Heppel et al., 1997)
g. Immunization Route
Intramuscular injection (i.m.)
h. Rainbow trout Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Young rainbow trout injected with the G construct, alone or together with the N construct, were strongly protected against challenge with live virus (Heppel et al., 1997).
2. VHSV DNA vaccine pCMV-vhsN encoding nucleocapsid protein N and glycoprotein G
a. Vaccine Ontology ID:
VO_0004339
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Rainbow trout
e. Gene Engineering of nucleocapsid
  • Type: DNA vaccine construction
  • Description: Vector pcDNA 3 expressed the gene encoding the nucleocapsid protein N (Heppel et al., 1997).
  • Detailed Gene Information: Click here.
f. Gene Engineering of Glycoprotein
  • Type: DNA vaccine construction
  • Description: Vector pcDNA3 expressed glycoprotein G gene of the virus (Heppel et al., 1997).
  • Detailed Gene Information: Click here.
g. Vector:
pcDNA 3 (Heppel et al., 1997)
h. Immunization Route
Intramuscular injection (i.m.)
i. Rainbow trout Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Young rainbow trout injected with the G construct together with the N construct were strongly protected against challenge with live virus (Heppel et al., 1997).
3. VHSV DNA vaccine pVHS-G encoding glycoproteins
a. Vaccine Ontology ID:
VO_0004494
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Fish
e. Gene Engineering of Glycoprotein
  • Type: DNA vaccine construction
  • Description: The pcDNA3.1(+) vector expressed viral glycoproteins (G proteins) (Lorenzen et al., 2002).
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3.1(+) vector (Lorenzen et al., 2002)
g. Immunization Route
Intramuscular injection (i.m.)
h. Rainbow trout Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Challenge experiments revealed that immunity established shortly after vaccination was cross-protective between the VHSV and IHNV whereas no increased survival was found upon challenge with bacterial pathogens. Within two months after vaccination, the cross-protection disappeared while the specific immunity to homologous virus remained high (Lorenzen et al., 2002).
IV. References
1. Heppel et al., 1997: JO√čL HEPPELL, NIELS LORENZEN, NEIL K. ARMSTRONG, TONG WU, ELLEN LORENZEN, KATJA EINER-JENSEN, JOACHIM SCHORR, HEATHER L. DAVIS. Development of DNA vaccines for fish: vector design, intramuscular injection and antigen expression using viral haemorrhagic septicaemia virus genes as model. Fish & Shellfish Immunology. 1997; 8(4); 271-286.
2. Lorenzen et al., 2002: Lorenzen N, Lorenzen E, Einer-Jensen K, LaPatra SE. Immunity induced shortly after DNA vaccination of rainbow trout against rhabdoviruses protects against heterologous virus but not against bacterial pathogens. Developmental and comparative immunology. 2002; 26(2); 173-179. [PubMed: 11696382].
3. WISC - VHSV: Viral Hemorrhagic Septicemia Virus [http://www.invasivespecies.wa.gov/priorities/viral_hemorrhagic.shtml]