VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Human cytomegalovirus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Introduction
    3. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. Glycoprotein B (Protective antigen)
    2. pp65 (Protective antigen)
  3. Vaccine Information
    1. Human cytomegalovirus DNA vaccine pcGB
    2. Human cytomegalovirus DNA vaccine VCL-CB01 encoding phosphoprotein 65 and gB
  4. References
I. General Information
1. NCBI Taxonomy ID:
10359
2. Introduction
Also known as human herpesvirus 5. Cytomegalovirus (CMV) is a common virus that can infect almost anyone. Most people don't know they have CMV because it rarely causes symptoms. However, if you're pregnant or have a weakened immune system, CMV is cause for concern.

Once infected with CMV, your body retains the virus for life. However, CMV usually remains dormant if you're healthy. CMV spreads through body fluids, such as blood, saliva, urine, semen and breast milk. People with weak immune systems have a greater risk of becoming ill from CMV. If you're pregnant and develop an active infection, you can pass the virus to your baby.

There's no cure for CMV, but drugs can help treat newborns and people with weak immune systems (Mayo Clinic - CMV).
3. Host Ranges and Animal Models
Humans
1. Glycoprotein B
  • Gene Name : Glycoprotein B
  • Sequence Strain (Species/Organism) : Human herpesvirus 5
  • NCBI Gene ID : 3077424
  • NCBI Protein GI : 52139241
  • Locus Tag : HHV5wtgp060
  • Genbank Accession : GQ466044
  • Protein Accession : YP_081514
  • Taxonomy ID : 10359
  • Gene Starting Position : 82065
  • Gene Ending Position : 84788
  • Gene Strand (Orientation) : -
  • Protein Name : envelope glycoprotein B
  • Protein pI : 7.31
  • Protein Weight : 94542.1
  • Protein Length : 907
  • DNA Sequence : Show Sequence
    >gi|155573622:82065-84788 Human herpesvirus 5, complete genome
    TTCAGACGTTCTCTTCTTCGTCAGAGTCTTTCAAGTGTCGGTAGCCGTTTTTGCGATGTCGCAGTCGGTC
    TAGTAGGTTGGGCTTCTGTCCCTTGTCCTGCGTGCCAGTCCGTCCGTCCAAAGAATCTGTACCGTTCTGC
    TGCGCTCGCTGCTCTGCGTCCAGACGGGCCAGGGCCAGAAGCATCTGGTAAGCCTGCTCGTTGGTGTAAG
    GCGGAGCCGCCGTGGATGCATCAGACGACGGTGGTCCCGGTCCTTTGCGACCAGAATTATAAACACTTTC
    CTCGTAGGAAGGCGGAGCCTGTAACGACGTGTCTTTGGTGCTGCCCGACGTCACGGTGGTCCCGTCGGCG
    GACACCAGATAGGGAAAGAGGTTCTGCAGCGGCTGCGTGCACAAACGCCGCTGTCGAGTATAGATCAAAT
    AAGTGATAATGACTACAGCTATGGCCACGAGGATGATGGTGAACGCTCCGAAGGGGTTTTTGAGGAAGGT
    GGCAACGCCTTCGACCACGGAGGCCACCGCGCCACCCACGGCCCCAATGGCTACGCCAACGGCCTTTCCC
    GCGGCGCCCAGGCCGCTCATGAGGTCGTCCAGACCCTTGAGGTAGGGCGGTAGCGGGTCGACTACCTTGT
    CCTCCACGTACTTTACCCGCTGCTTGTACGAGTTGAATTCGCGCATGATCTCTTCGAGGTCAAAAACGTT
    GCTGGAACGCAGCTCTTTCTGCGAGTAAAGTTCCAGTACCCTGAAGTCGGTATTTTCCAGCGGGTCGATA
    TCCAGGGCGATCATGCTGTCGACGGTGGAGATACTGCTGAGGTCAATCATGCGTTTGAAGAGGTAGTCCA
    CGTACTCGTAGGCCGAGTTCCCGGCGATGAAGATCTTGAGGCTGGGAAGCTGACATTCCTCAGTGCGGTG
    GTTGCCCAACAGGATTTCGTTGTCCTCGCCCAGTTGACCGTACTGCACGTACGAGCTGTTGGCGAAATTA
    AAGATGACCACGGGTCGTGAGTAGCAGCGTCCTGGCGACTCCTTCACGTTCATATCACGCAGCACCTTGA
    CGCTGGTTTGGTTGATGGTCACGCAGCTGGCCAGGCCCAAGACATCACCCATGAAACGCGCGGCAATCGG
    TTTGTTGTAAATGGCCGAGAGAATGGCTGACGGGTTGATCTTGCTGAGTTCCTTGAAGACCTCTAGGGTG
    CGCCGTTGATCCACACACCAGGCTTCTGCGATTTGCGCCAGCGCCCGGTTGATGTAACCGCGCAACGTGT
    CATAGGTGAACTGCAGCTGGGCGTAGACCAGATTGTGCACCGATTCCATGTTGGATAAATGAGTTGCATT
    GTTGCCATCTGTACTTCTTTTGGTTCTATTATGAGTAAGATTCAGACTGGAGCGGTTGGCCAAACGTTCG
    AGTTCCACCAGAGATTTTTGCTTGATACCTTGCCAGAACACTACCAAACCACCAGTGGTTTCAAAGACGG
    ACACGTTTCCATATTTTTCATATGTTTGATTGTATGAAGTATTGAAAATCTGCTGTAACTTATTTATAGC
    CTCATCACGTACGCAGTCCAGCGCAGAGTCGGACATGTTCACCTCTTGCTTCTTAGATAAGAAAGTGGCG
    GTCATTTTGGCAGAAGAAAAGTGATACGAGTCCTCGGCTTCGGAACGAATGGTGCGTTCCGAGGCTTCCC
    AGAAAGTGAGTTGACAAGTGACATTCTTTTCGTCCTGTATATCCCAGGAGATCACCGAGTCCGCACGTTC
    AAGAAAAGCCACCAACCTGTGGGTCTCTAACGCAGAATTCGGTCTTCCAAAGTCGGAGACGATAGTGTAG
    TTCGGAAAAATGAAAAACTTGTCGGCGTTTTCTCCAAAGTAGCTGGCATTGCGATTGGTTCCGTTGTAGA
    AAGGAGAAATGTCAACCACGTCACCCGTGGAAGTGGCGAAAAAATGATAAGGATATTTGGAGCGCGCAGT
    AGTGATGGTCACCATACAATTCAGATTACAGGTCTCACGATAGAGCCAGGTGCTGCCGCGGCTGTGCCAT
    TGATCCTTGACCGTCACGTAACGGGTACTGTGGGTGTTGGAATAATCGTCGGGCATTAATTGCATGGTTT
    TGTTTTCATAGCTGTCCCTATGATAAGCCACGAAAACCGTGCCTGCTATAACGCGGCTGTAGGAACTGTA
    GCACTGACTGTGGCTGTTGATATGATGAATCTCCCACATAGGAGGCGCCACGTATTCCGTGTTGCTGCCC
    AGCAGATAAGTGGTGTGGATGTAAGCGTAGCTACGACGAAACGTCAAAACCTTCTGGTAGACTCGTACCT
    TAAAGGTGTGCGCGACGATGTTGCGTTTGTAGACCACCATGATGCCCTCGTCCAGGTCTTCATTGATGGG
    CTTCATCGAGGTGCAGACGATATTACGTTCAAAGCGAATAAGATCCGTACCCTGGGCCATAGAACACACG
    CGATAGGGGTACTTGGTGGTATTGACCCCCACCACATCTCCGTACTTGAGGGTAGTGTTGTAGATGGTCT
    CGTTAACACCATGGCTGACCGTTTGGGAAGAAGTTACGCGTTGAGAGACTGAACCGGATCGAGAGTGAGC
    AGCAGACGTCGTATGAGAGGAATGGTGACTGTGAGTAGCAGAAGTTCCACGAGTAGAAGATGAGGAAACC
    GCAGCACCCAGACAGACGATACACAAGTTAACGCAGACTACCAGGCACCAGATCCTGGATTCCA
  • Protein Sequence : Show Sequence
    >gi|52139241|ref|YP_081514.1| envelope glycoprotein B [Human herpesvirus 5]
    MESRIWCLVVCVNLCIVCLGAAVSSSSTRGTSATHSHHSSHTTSAAHSRSGSVSQRVTSSQTVSHGVNET
    IYNTTLKYGDVVGVNTTKYPYRVCSMAQGTDLIRFERNIVCTSMKPINEDLDEGIMVVYKRNIVAHTFKV
    RVYQKVLTFRRSYAYIHTTYLLGSNTEYVAPPMWEIHHINSHSQCYSSYSRVIAGTVFVAYHRDSYENKT
    MQLMPDDYSNTHSTRYVTVKDQWHSRGSTWLYRETCNLNCMVTITTARSKYPYHFFATSTGDVVDISPFY
    NGTNRNASYFGENADKFFIFPNYTIVSDFGRPNSALETHRLVAFLERADSVISWDIQDEKNVTCQLTFWE
    ASERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDSALDCVRDEAINKLQQIFNTSYNQTYEKYGNVSV
    FETTGGLVVFWQGIKQKSLVELERLANRSSLNLTHNRTKRSTDGNNATHLSNMESVHNLVYAQLQFTYDT
    LRGYINRALAQIAEAWCVDQRRTLEVFKELSKINPSAILSAIYNKPIAARFMGDVLGLASCVTINQTSVK
    VLRDMNVKESPGRCYSRPVVIFNFANSSYVQYGQLGEDNEILLGNHRTEECQLPSLKIFIAGNSAYEYVD
    YLFKRMIDLSSISTVDSMIALDIDPLENTDFRVLELYSQKELRSSNVFDLEEIMREFNSYKQRVKYVEDK
    VVDPLPPYLKGLDDLMSGLGAAGKAVGVAIGAVGGAVASVVEGVATFLKNPFGAFTIILVAIAVVIITYL
    IYTRQRRLCTQPLQNLFPYLVSADGTTVTSGSTKDTSLQAPPSYEESVYNSGRKGPGPPSSDASTAAPPY
    TNEQAYQMLLALARLDAEQRAQQNGTDSLDGRTGTQDKGQKPNLLDRLRHRKNGYRHLKDSDEEENV
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Human cytomegalovirus DNA vaccine pcGB , Human cytomegalovirus DNA vaccine VCL-CB01 encoding phosphoprotein 65 and gB
2. pp65
  • Gene Name : pp65
  • Sequence Strain (Species/Organism) : Human herpesvirus 5
  • NCBI Protein GI : 270355835
  • Other Database IDs : CDD:114506
  • Taxonomy ID : 10359
  • Gene Strand (Orientation) : ?
  • Protein Name : tegument protein pp65
  • Protein Length : 561
  • Protein Note : unpassaged strain in the original clinical sample; acronym: HCMV; acronym: HHV-5
  • Protein Sequence : Show Sequence
    >gi|270355835|gb|ACZ79994.1| tegument protein pp65 [Human herpesvirus 5]
    MESRGRRCPDMISVLGPISGHVLKAVFSRGDTPVLPHETRLLQTGIHVRVSQPSLILVSQYTPDSTPCHR
    GDNQLQVQHTYFTGSEVENVSVNVHNPTGRSICPSQEPMSIYVYALPLKMLNIPSINVHHYPSAAERKHR
    HLPVADAVIHASGKQMWQARLTVSGLAWTRQQNQWKEPDVYYTSAFVFPTKDVALRHVVCAHELVCSMEN
    TRATKMQVIGDQYVKVYLESFCEDVPSGKLFMHVTLGSDVEEDLTMTRNPQPFMRPHERNGFTVLCPKNM
    IIKPGKISHIMLDVAFTSHEHFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIRETVELRQYDPVAALFF
    FDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRV
    TGGGAMAGASTSAGRKRKSASSATACTAGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAG
    ILARNLVPMVATVQGQNLKYQEFFWDANDIYRIFAELEGVWQPAAQPKRRRHRQEALPGPCIASTPKKHR
    G
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Human cytomegalovirus DNA vaccine VCL-CB01 encoding phosphoprotein 65 and gB
III. Vaccine Information
1. Human cytomegalovirus DNA vaccine pcGB
a. Vaccine Ontology ID:
VO_0004599
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of Glycoprotein B
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3 (Hwang et al., 1999)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0003057
  • Efficacy: Neutralizing antibody was developed, and the percent reduction of input infectivity in 1:100 diluted sera was 74.5% in three-times immunized groups. The induction of neutralizing antibody with HCMV gB in this study might be useful to attenuate or prevent HCMV infection (Hwang et al., 1999).
2. Human cytomegalovirus DNA vaccine VCL-CB01 encoding phosphoprotein 65 and gB
a. Vaccine Ontology ID:
VO_0004341
b. Type:
DNA vaccine
c. Status:
Clinical trial
d. Host Species as Laboratory Animal Model:
Human
e. Gene Engineering of Glycoprotein B
  • Type: DNA vaccine construction
  • Description: This DNA vaccine expressed the major hCMV surface glycoprotein B (Schleiss, 2009).
  • Detailed Gene Information: Click here.
f. Gene Engineering of pp65
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Immunization Route
Intramuscular injection (i.m.)
h. Human Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: VCL-CB01 increased T-cell responses compared with placebo (Schleiss, 2009).
i. Mouse Response
  • Vaccine Immune Response Type: VO_0003057
  • Efficacy: Preclinical investigation of the hCMV gB/pp65 DNA vaccine was initially conducted in mice. When formulated in PBS, lone gB and pp65 plasmids were highly immunogenic, but vaccination with the bivalent vaccine reduced immune responses to each antigen by 2.8- and 4-fold of the lone values, respectively. However, formulating the bivalent vaccine with 02A significantly (p = 0.048) increased the antigen-specific immune responses relative to those induced with the bivalent vaccine in PBS, as well as completely abrogating a decrease in pp65-specific T-cell responses (Schleiss, 2009).
IV. References
1. Hwang et al., 1999: Hwang ES, Kwon KB, Park JW, Kim DJ, Park CG, Cha CY. Induction of neutralizing antibody against human cytomegalovirus (HCMV) with DNA-mediated immunization of HCMV glycoprotein B in mice. Microbiology and immunology. 1999; 43(3); 307-310. [PubMed: 10338203].
2. Mayo Clinic - CMV: Cytomegalovirus (CMV) infection [http://www.mayoclinic.com/health/cmv/DS00938]