VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Hepatitis E virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. ORF-2 (Other)
    2. Hepatitis E Virus E2s Domain (Protective antigen)
    3. ORF1 (Protective antigen)
    4. ORF2 (Protective antigen)
  3. Vaccine Information
  4. References
I. General Information
1. NCBI Taxonomy ID:
12461
2. Disease:
Hepatitis E
3. Introduction
Hepatitis E is a serious liver disease caused by the Hepatitis E virus (HEV) that usually results in an acute infection. It does not lead to a chronic infection. While rare in the United States, Hepatitis E is common in many parts of the world. Transmission: Ingestion of fecal matter, even in microscopic amounts; outbreaks are usually associated with contaminated water supply in countries with poor sanitation (CDC - Hepatitis E).
1. Hepatitis E Virus E2s Domain
  • Gene Name : Hepatitis E Virus E2s Domain
  • Sequence Strain (Species/Organism) : Hepatitis E virus
  • NCBI Protein GI : 3RKD_B
  • Other Database IDs : CDD:281067
  • Taxonomy ID : 12461
  • Protein Name : Hepatitis E Virus E2s Domain
  • Protein pI : 8.67
  • Protein Weight : 14713.19
  • Protein Length : 186
  • Protein Note : Structural protein 2; pfam03014
  • Protein Sequence : Show Sequence
    >pdb|3RKD|B Chain B, Capsid Protein
    SRPFSVLRANDVLWLSLTAAEYDQSTYGSSTGPVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLST
    IQQHSKTFFVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAV
    AVLAPP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Li et al., 2009)
2. ORF-2
  • Gene Name : ORF-2
  • Sequence Strain (Species/Organism) : Hepatitis E virus
  • NCBI Gene ID : 1494410
  • NCBI Protein GI : 9626450
  • Locus Tag : HEVgp10
  • Genbank Accession : L08816
  • Protein Accession : NP_056788
  • Taxonomy ID : 12461
  • Gene Starting Position : 5122
  • Gene Ending Position : 7104
  • Gene Strand (Orientation) : +
  • Protein Name : capsid protein
  • Protein pI : 9.05
  • Protein Weight : 66613.67
  • Protein Length : 660
  • DNA Sequence : Show Sequence
    >gi|9626440:5122-7104 Hepatitis E virus, complete genome
    CATGCGCCCTCGGCCTATTTTGCTGTTGCTCCTCATGTTTCTGCCTATGCTGCCCGCGCCACCGCCCGGT
    CAGCCGTCTGGCCGCCGCCGTGGGCGGCGCAGCGGCGGTTCCGGCGGTGGTTTCTGGGGTGACCGGGCTG
    ATTCTCAGCCCTTCGCAATCCCCTATATTCATCCAACCAACCCCTTCGCCCCCGATGTCACCGCTGCGGC
    CGGGGCTGGACCTCGTGTTCGCCAACCCGCCCGACCACTCGGCTCCGCTTGGCGTGACCAGGCCCAGCGC
    CCCGCCGCTGCCTCACGTCGTAGACCTACCACAGCTGGGGCCGCGCCGCTAACCGCGGTCGCTCCGGCCC
    ATGACACCCCGCCAGTGCCTGATGTTGACTCCCGCGGCGCCATCCTGCGCCGGCAGTATAACCTATCAAC
    ATCTCCCCTTACCTCTTCCGTGGCCACCGGTACAAACTTGGTTCTTTACGCCGCTCCTCTTAGCCCGCTT
    CTACCCCTCCAGGACGGCACCAATACTCATATAATGGCTACAGAAGCTTCTAATTATGCCCAGTACCGGG
    TTGTTCGTGCTACAATTCGCTACCGCCCGCTGGTCCCCAACGCTGTTGGTGGCTACGCCATCTCCATCTC
    GTTCTGGCCACAGACCACCACCACCCCGACGTCCGTTGACATGAATTCAATAACCTCGACTGATGTTCGT
    ATTTTAGTCCAGCCCGGCATAGCCTCCGAGCATGTTATCCCAAGTGAGCGCCTACACTATCGTAACCAAG
    GTTGGCGCTCTGTTGAGACCTCCGGGGTGGCGGAGGAGGAGGCCACCTCTGGTCTTGTTATGCTTTGCAT
    ACATGGCTCACTCGTAAACTCTTATACTAATACACCTTATACCGGTGCCCTCGGGCTGTTGGACTTTGCC
    CTCGAACTTGAGTTCCGCAACCTCACCCCCGGTAATACCAACACGCGGGTCTCCCGTTACTCCAGCACTG
    CCCGTCACCGCCTTCGTCGCGGTGCAGATGGGACTGCCGAGCTCACCACCACGGCTGCTACCCGCTTCAT
    GAAGGACCTCTATTTTACTAGTACTAATGGTGTCGGTGAGATCGGCCGCGGGATAGCGCTTACCCTGTTT
    AACCTTGCTGACACCCTGCTTGGCGGTCTACCGACAGAATTGATTTCGTCGGCTGGTGGCCAGCTGTTCT
    ACTCTCGCCCCGTCGTCTCAGCCAATGGCGAGCCGACTGTTAAGCTGTATACATCTGTAGAGAATGCTCA
    GCAGGATAAGGGTATTGCAATCCCGCATGACATCGACCTCGGGGAATCTCGTGTAGTTATTCAGGATTAT
    GATAACCAACATGAGCAGGACCGACCGACACCTTCCCCAGCCCCATCGCGCCCCTTTTCTGTCCTCCGAG
    CTAATGATGTGCTTTGGCTTTCTCTCACCGCTGCCGAGTATGACCAGTCCACTTACGGCTCTTCGACCGG
    CCCAGTCTATGTCTCTGACTCTGTGACCTTGGTTAATGTAGCGACCGGCGCGCAGGCCGTTGCCCGGTCG
    CTCGACTGGACCAAGGTCACACTTGATGGTCGCCCCCTTTCCACCACCCAGCAGTATTCAAAGACCTTCT
    TTGTCCTGCCGCTCCGCGGTAAGCTCTCCTTTTGGGAGGCAGGTACTACTAAAGCCGGGTACCCTTATAA
    TTATAACACCACTGCTAGTGACCAACTGCTCGTTGAGAATGCCGCTGGGCATCGGGTTGCTATTTCCACT
    TACACCACTAGCCTGGGTGCTGGCCCCGTCTCTATTTCCGCGGTTGCTGTTTTAGCCCCCCACTCTGCGC
    TAGCATTGCTTGAGGATACCATGGACTACCCTGCCCGCGCCCATACTTTCGATGACTTCTGCCCGGAGTG
    CCGCCCCCTTGGCCTCCAGGGCTGTGCTTTTCAGTCTACTGTCGCTGAGCTTCAGCGCCTTAAGATGAAG
    GTGGGTAAAACTCGGGAGTTATA
  • Protein Sequence : Show Sequence
    >gi|9626450|ref|NP_056788.1| capsid protein [Hepatitis E virus]
    MRPRPILLLLLMFLPMLPAPPPGQPSGRRRGRRSGGSGGGFWGDRADSQPFAIPYIHPTNPFAPDVTAAA
    GAGPRVRQPARPLGSAWRDQAQRPAAASRRRPTTAGAAPLTAVAPAHDTPPVPDVDSRGAILRRQYNLST
    SPLTSSVATGTNLVLYAAPLSPLLPLQDGTNTHIMATEASNYAQYRVVRATIRYRPLVPNAVGGYAISIS
    FWPQTTTTPTSVDMNSITSTDVRILVQPGIASEHVIPSERLHYRNQGWRSVETSGVAEEEATSGLVMLCI
    HGSLVNSYTNTPYTGALGLLDFALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFM
    KDLYFTSTNGVGEIGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPVVSANGEPTVKLYTSVENAQ
    QDKGIAIPHDIDLGESRVVIQDYDNQHEQDRPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQSTYGSSTG
    PVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLSTTQQYSKTFFVLPLRGKLSFWEAGTTKAGYPYN
    YNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAVAVLAPHSALALLEDTMDYPARAHTFDDFCPEC
    RPLGLQGCAFQSTVAELQRLKMKVGKTREL
  • Molecule Role : Other
3. ORF1
  • Gene Name : ORF1
  • Sequence Strain (Species/Organism) : Hepatitis E virus
  • NCBI Protein GI : BAD35096
  • Other Database IDs : CDD:110646
  • Taxonomy ID : 12461
  • Protein Name : ORF1
  • Protein pI : 11.17
  • Protein Weight : 14981.95
  • Protein Length : 186
  • Protein Note : genotype 4
  • Protein Sequence : Show Sequence
    >BAD35096.1 ORF1, partial [Hepatitis E virus]
    QFIKAPGVTTAIEQAALAAANSALANAVVVRPFLSRLQTEILINLMQPRQLVFRPEVLWNHPIQRVIHNE
    LEQYCRARAGRCLEVGAHPRSINDNPNVLHRCFLKPVGRDVQRWYTAPTRGPAANCRRSALRGLPPA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Al-Ayoubi et al., 2018)
4. ORF2
  • Gene Name : ORF2
  • Sequence Strain (Species/Organism) : Hepatitis E virus
  • NCBI Protein GI : AAA03191
  • Other Database IDs : CDD:281067
  • Taxonomy ID : 12461
  • Protein Name : ORF2
  • Protein pI : 9.05
  • Protein Weight : 67396.48
  • Protein Length : 709
  • Protein Note : Structural protein 2; pfam03014
  • Protein Sequence : Show Sequence
    >AAA03191.1 ORF 2 [Hepatitis E virus]
    MRPRPILLLLLMFLPMLPAPPPGQPSGRRRGRRSGGSGGGFWGDRADSQPFAIPYIHPTNPFAPDVTAAA
    GAGPRVRQPARPLGSAWRDQAQRPAAASRRRPTTAGAAPLTAVAPAHDTPPVPDVDSRGAILRRQYNLST
    SPLTSSVATGTNLVLYAAPLSPLLPLQDGTNTHIMATEASNYAQYRVVRATIRYRPLVPNAVGGYAISIS
    FWPQTTTTPTSVDMNSITSTDVRILVQPGIASEHVIPSERLHYRNQGWRSVETSGVAEEEATSGLVMLCI
    HGSLVNSYTNTPYTGALGLLDFALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFM
    KDLYFTSTNGVGEIGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPVVSANGEPTVKLYTSVENAQ
    QDKGIAIPHDIDLGESRVVIQDYDNQHEQDRPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQSTYGSSTG
    PVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLSTTQQYSKTFFVLPLRGKLSFWEAGTTKAGYPYN
    YNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAVAVLAPHSALALLEDTMDYPARAHTFDDFCPEC
    RPLGLQGCAFQSTVAELQRLKMKVGKTREL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Joshi and Arankalle, 2016)
III. Vaccine Information
IV. References
1. Al-Ayoubi et al., 2018: Al-Ayoubi J, Behrendt P, Bremer B, Suneetha PV, Gisa A, Rinker F, Manns MP, Cornberg M, Wedemeyer H, Kraft ARM. Hepatitis E virus ORF 1 induces proliferative and functional T-cell responses in patients with ongoing and resolved hepatitis E. Liver international : official journal of the International Association for the Study of the Liver. 2018; 38(2); 266-277. [PubMed: 28718943].
2. CDC - Hepatitis E: Hepatitis E Information for Health Professionals [http://www.cdc.gov/hepatitis/HEV/]
3. He et al., 1997: He J, Hoffman SL, Hayes CG. DNA inoculation with a plasmid vector carrying the hepatitis E virus structural protein gene induces immune response in mice. Vaccine. 1997; 15(4); 357-362. [PubMed: 9141205].
4. Joshi and Arankalle, 2016: Joshi SS, Arankalle VA. Differential Immune Responses in Mice Immunized with Recombinant Neutralizing Epitope Protein of Hepatitis E Virus Formulated with Liposome and Alum Adjuvants. Viral immunology. 2016; 29(6); 350-360. [PubMed: 27285290].
5. Li et al., 2009: Li S, Tang X, Seetharaman J, Yang C, Gu Y, Zhang J, Du H, Shih JW, Hew CL, Sivaraman J, Xia N. Dimerization of hepatitis E virus capsid protein E2s domain is essential for virus-host interaction. PLoS pathogens. 2009; 5(8); e1000537. [PubMed: 19662165].