VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Experimental autoimmune uveitis

Table of Contents
  1. General Information
    1. Disease
    2. Introduction
  2. Vaccine Related Pathogen Genes
    1. IRBP (Other)
    2. IRBP from humans (Protective antigen)
  3. Vaccine Information
    1. EAU DNA vaccine IRBP-DNA encoding IRBP
  4. References
I. General Information
1. Disease:
Experimental autoimmune uveitis
2. Introduction
Experimental autoimmune uveitis (EAU) is an organ-specific, T cell–mediated disease that targets the posterior pole of the eye. It is also a valuable, well-characterized model for the study of human idiopathic uveitis. This disease can be induced in susceptible primates and rodents after immunization with retinal self-antigens, such as interphotoreceptor retinoid-binding protein (IRBP) or S-antigen (arrestin), or by the adoptive transfer of uveitis antigen-specific T cells (Commodaro et al., 2010).
1. IRBP
  • Gene Name : IRBP
  • Sequence Strain (Species/Organism) : Mus musculus
  • NCBI Protein GI : 4689280
  • Other Database IDs : CDD:143479
  • Taxonomy ID : 10090
  • Gene Strand (Orientation) : ?
  • Protein Name : retinoid-binding protein IRBP
  • Protein Length : 610
  • Protein Note : Interphotoreceptor retinoid-binding protein; serine protease family S41; cd07563
  • Protein Sequence : Show Sequence
    >gi|4689280|gb|AAA39331.2| retinoid-binding protein IRBP [Mus musculus]
    MMREWVLVLSTLLWVPAGPTHLFQPSLVLDMAKILLDNYCFPENLMGMQAAIEQAMKSHEILGISDPQTL
    AQVLTAGVQSSLSDPRLFISYEPSTLEAPQQAPVLTNLTREELLAQIQRNIRHEVLEGNVGYLRVDDLPG
    QEVLSELGEFLVSHVWRQLMSTSSLVLDLRHCSGGHFSGIPYVISYLHPGNTVMHVDTVYDRPSNTTTEI
    WTLPEVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTV
    PVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGL
    LHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRDSSSRPETGPNESPAATPEVPTEEDAR
    RALVDSVFQVSVLPGNVGYLRFDRFADAAVLETLGPYVLKQVWEPLQDTEHLIMDLRHNPGGPSSAMPLV
    LSYFQGPEAGPVRLFTTYDRRTNITQEHFSHRELLGQRYGNQRGVYLLTSHRTATAAEEFAFLMQSLGWA
    TLVGEITAGSLLHTCTVPLLDSPQGGLALTVPVLTFIDNHGEAWLGGGVV
  • Molecule Role : Other
2. IRBP from humans
  • Gene Name : IRBP from humans
  • Sequence Strain (Species/Organism) : Homo sapiens
  • NCBI Gene ID : 5949
  • NCBI Protein GI : 4506453
  • Genbank Accession : AH002852
  • Protein Accession : NP_002891
  • Taxonomy ID : 9606
  • Chromosome No : 10
  • Gene Starting Position : 47348370
  • Gene Ending Position : 47357874
  • Gene Strand (Orientation) : +
  • Protein Name : retinol binding protein 3
  • Protein pI : 4.76
  • Protein Weight : 124350.97
  • Protein Length : 1247
  • Protein Note : Also known as IRBP; RBPI; D10S64; D10S65; D10S66
  • DNA Sequence : Show Sequence
    >NC_000010.11:47348370-47357874 Homo sapiens chromosome 10, GRCh38.p12 Primary Assembly
    CTGTCCACCAGCTGAGAAGGACAAGGGCGGAAGGCAGCTGCACAGAGCAGGGCCACGGCCTTGCACACAG
    TCCAGGGAGCTTTTGTGCAGGAGCCAGGCCTCCCCCTGGGTCCCCATGATGAGAGAATGGGTTCTGCTCA
    TGTCCGTGCTGCTCTGTGGCCTGGCTGGCCCCACACACCTGTTCCAGCCAAGCCTGGTGCTGGACATGGC
    CAAGGTCCTCTTGGATAACTACTGCTTCCCGGAGAACCTGCTGGGCATGCAGGAAGCCATCCAGCAGGCC
    ATCAAGAGCCATGAGATTCTGAGCATCTCAGACCCGCAGACGCTGGCCAGTGTGCTGACAGCCGGGGTGC
    AGAGCTCCCTGAACGATCCTCGCCTGGTCATCTCCTATGAGCCCAGCACCCCCGAGCCTCCCCCACAAGT
    CCCAGCACTCACCAGCCTCTCAGAAGAGGAACTGCTTGCCTGGCTGCAAAGGGGCCTCCGCCATGAGGTT
    CTGGAGGGTAATGTGGGCTACCTGCGGGTGGACAGCGTCCCGGGCCAGGAGGTGCTGAGCATGATGGGGG
    AGTTCCTGGTGGCCCACGTGTGGGGGAATCTCATGGGCACCTCCGCCTTAGTGCTGGATCTCCGGCACTG
    CACAGGAGGCCAGGTCTCTGGCATTCCCTACATCATCTCCTACCTGCACCCAGGGAACACCATCCTGCAC
    GTGGACACTATCTACAACCGCCCCTCCAACACCACCACGGAGATCTGGACCTTGCCCCAGGTCCTGGGAG
    AAAGGTACGGTGCCGACAAGGATGTGGTGGTCCTCACCAGCAGCCAGACCAGGGGCGTGGCCGAGGACAT
    CGCGCACATCCTTAAGCAGATGCGCAGGGCCATCGTGGTGGGCGAGCGGACTGGGGGAGGGGCCCTGGAC
    CTCCGGAAGCTGAGGATAGGCGAGTCTGACTTCTTCTTCACGGTGCCCGTGTCCAGGTCCCTGGGGCCCC
    TTGGTGGAGGCAGCCAGACGTGGGAGGGCAGCGGGGTGCTGCCCTGTGTGGGGACTCCGGCCGAGCAGGC
    CCTGGAGAAAGCCCTGGCCATCCTCACTCTGCGCAGCGCCCTTCCAGGGGTAGTCCACTGCCTCCAGGAG
    GTCCTGAAGGACTACTACACGCTGGTGGACCGTGTGCCCACCCTGCTGCAGCACTTGGCCAGCATGGACT
    TCTCCACGGTGGTCTCCGAGGAAGATCTGGTCACCAAGCTCAATGCCGGCCTGCAGGCTGCGTCTGAGGA
    TCCCAGGCTCCTGGTGCGAGCCATCGGGCCCACAGAAACTCCTTCTTGGCCCGCGCCCGACGCTGCAGCC
    GAAGACTCACCAGGGGTGGCCCCAGAGTTGCCTGAGGACGAGGCTATCCGGCAAGCACTGGTGGACTCTG
    TGTTCCAGGTGTCGGTGCTGCCAGGCAATGTGGGCTACCTGCGCTTCGATAGTTTTGCTGACGCCTCCGT
    CCTGGGTGTGTTGGCCCCATATGTCCTGCGCCAGGTGTGGGAGCCGCTACAGGACACGGAGCACCTCATC
    ATGGACCTGCGCCACAACCCTGGAGGGCCATCCTCTGCTGTGCCCCTGCTCCTGTCCTACTTCCAGGGCC
    CTGAGGCCGGCCCCGTGCACCTCTTCACCACCTATGATCGCCGCACCAACATCACGCAGGAGCACTTCAG
    CCACATGGAGCTCCCGGGCCCACGCTACAGCACCCAACGTGGGGTGTATCTGCTCACCAGCCACCGCACC
    GCCACGGCCGCGGAGGAGTTCGCCTTCCTTATGCAGTCGCTGGGCTGGGCCACACTGGTAGGTGAGATCA
    CCGCGGGCAACCTGCTGCACACCCGCACGGTGCCGCTGCTGGACACACCCGAAGGCAGCCTCGCGCTCAC
    CGTGCCGGTCCTCACCTTCATCGACAATCACGGCGAGGCCTGGCTGGGTGGTGGAGTGGTGCCCGATGCC
    ATCGTGCTGGCCGAGGAGGCCCTGGACAAAGCCCAGGAAGTGCTGGAGTTCCACCAAAGCCTGGGGGCCT
    TGGTGGAGGGCACAGGGCACCTGCTGGAGGCCCACTATGCTCGGCCAGAGGTCGTGGGGCAGACCAGTGC
    CCTCCTGCGGGCCAAGCTGGCCCAGGGCGCCTACCGCACAGCTGTGGACTTGGAGTCTCTGGCCTCTCAG
    CTCACAGCAGACCTCCAGGAGGTGTCTGGGGACCACCGCTTGCTAGTGTTCCACAGCCCTGGCGAGCTGG
    TGGTAGAGGAAGCACCCCCACCACCCCCTGCTGTCCCCTCTCCAGAGGAGCTCACCTACCTTATTGAGGC
    CCTGTTCAAGACAGAGGTGCTGCCCGGCCAGCTGGGCTACCTGCGTTTTGACGCCATGGCTGAACTGGAG
    ACAGTGAAGGCCGTGGGGCCACAGCTGGTGCGGCTGGTATGGCAACAGCTGGTGGACACGGCTGCGCTGG
    TGATCGACCTGCGCTACAACCCTGGCAGCTACTCCACGGCCATCCCGCTGCTCTGCTCCTACTTCTTTGA
    GGCAGAGCCCCGCCAGCACCTGTATTCTGTCTTTGACAGGGCCACCTCAAAAGTCACGGAGGTGTGGACC
    TTGCCCCAGGTCGCCGGCCAGCGCTACGGCTCACACAAGGACCTCTACATCCTGATGAGCCACACCAGTG
    GCTCTGCGGCCGAGGCCTTTGCACACACCATGCAGGACCTGCAGCGGGCCACGGTCATTGGGGAGCCCAC
    GGCCGGAGGCGCACTCTCTGTGGGCATCTACCAGGTGGGCAGCAGCCCCTTATATGCATCCATGCCCACC
    CAGATGGCCATGAGTGCCACCACAGGCAAGGCCTGGGACCTGGCTGGTGTGGAGCCCGACATCACTGTGC
    CCATGAGCGAAGCCCTTTCCATAGCCCAGGACATAGTGGCTCTGCGTGCCAAGGTGCCCACGGTGCTGCA
    GACGGCCGGGAAGCTGGTGGCTGATAACTATGCCTCTGCCGAGCTGGGGGCCAAGATGGCCACCAAACTG
    AGCGGTCTGCAGAGCCGCTACTCCAGGGTGACCTCAGAAGTGGCCCTAGCCGAGATCCTGGGGGCTGACC
    TGCAGATGCTCTCCGGAGACCCACACCTGAAGGCAGCCCATATCCCTGAGAATGCCAAGGACCGCATTCC
    TGGAATTGTGCCCATGCAGGTGAGACCCAAGAGAGACCTGGCTGAACCCAGTCCCGGGAGTGAGTTGACC
    CATTGTCCGCACATGCAGGGCTCTGTGCACAGTGCGTGACAATGGCTTTTAGATTTGTTCTCACGTTTAA
    GTTTTGACCGGTCAAGTCCTTTCCTCTTTCTCAACCTGTTCCATCCACTCTCTGTGACCCTGGGGTTGCT
    GAACACCTCTGTAGAACATTCATATTAGGTTGGTGCAAAAGTACTTTCAATGGCAAAACCCGCAATTACT
    TTTGCACCCACCTCACAGGAAGCCAGTTTGAAAGCCAACCAATACTCACAGGAAGCCAGTTCGGAAGCTC
    CTGGGATAGAAGGCATTTCAGCCTTGGCTGGGTGGAAGGTGAGTGTTGGCAGGGCTTCTCATTGTCAGTG
    CTAGGGAAGAGGCCAACACCTGTCAGAGGTGGCCAATGGACTTCACCAAGTGCCCCACGCTGGCCGAGAG
    CTCCACCTAGGCAGCACTCACACCTCCACACTGTTCTACCTGTGGTCTGCTGCATCGTCACAATTGGGCA
    GGGCAGCATTTGCCATGGGATCCCTTGCAAGGAGGGTCTGAGACCAGGGCTTGGGTGCAGGCGCTTTGTC
    TGGGAGGCGGTTACTGAAGCAGGCATGAAGGAGGGAGCAGGGAGAGTGGGTTGGGAAGCTGACAGGCAGG
    TGCCTCAAAGCTGTTCTGCTGAAGCCAGGACCCTGACGAGTGCAGGGATGCTCCCAGGCATAGCCCTCTG
    CAGGCAGGGCCCAGTGGTTCCTGTCCCGCATTGGCCAAGAGTTGCCCTGAGACATGCCTCAGGGTGGGGC
    AGGCTCCCTCTTCTTGGAGAAGGCCTGAGCTACGGGTGGAAAGGCAGGGCTGTGCTATAGGAGAGCCTGT
    CAGTGGGGTCGGGTGCAGCTGAAAGCAGAGGGGGCTGAGAGTGCCAAAAGCATCTACTACAGAATTGTTA
    TCCCCATTTTCCGCAACTGAGGCCCGGAGAGGAGCAGAGGGGAGTGGCCTGAGGCCAGAGAGCTGTGACT
    GAGGGCAGGGCAGGGCCTGGAGGGCAGTGTCTCTGTCAATGAAGTCTCCTTGCCTGTCAATCTCACCAAG
    ACCTGCCTCCCTCCAGCAGCCTTAGAGAGGGAGGAGGAGGTGCATCCACGTGCGAGTAGCCTGTGCTAGG
    CTTGCAGAATCCCCAGTTTCCAAATCAACATCTCCTTCCTTTCCAGTATAGCCAAGGTTCACGATTTGGA
    GTCAGATGTGGATTCAGATTCTGGCTCCACCACTTACTGACTGTGTGACCTGAGACTAGTTACTTAATCT
    CTCTGTGCTTCAGTTTTTCCATGGAAAAGATGGGGATCGTGTTATCTCCTGTACAGGTGGCTGTGAGGAT
    GATGATAAGCTCTACAAAGTGCTTAGTACCGGGCCAGGTGCCTGGTAAAGGTAACTAACATCTTCCAATC
    CTGCCCCAGTGGAGCAGCTTAGAGACATAGGAAGTATCTGGTAAGGTTGGAGAGGTCAGAGGGGAGTCCA
    TTCCTGGGCCTTCTAGCTCAGGACACCAGGGCATGTGGGTGGCAGACAGGAGCATCCTCTGCAAGGAGGC
    TGCCCATAGATCACACATGTCCCAGTGGCATGTCACATCCAGACATGCCACTGGGAAAGTCCCTGGTGTC
    TACTAATTCCTTCAGAAATGTTAGTTCCTGTCCCATGCCCTTAATATTTCCCATGGCGCCTGCTTTCCTG
    GGCTCTAAAACTGGCTGCTCCTCCTGACACTGAGTAGGACCTCCAACTCTTACAGATCCCTTCCCCTGAA
    GTATTTGAAGAGCTGATCAAGTTTTCCTTCCACACTAACGTGCTTGAGGACAACATTGGCTACTTGAGGT
    TTGACATGTTTGGGGACGGTGAGCTGCTCACCCAGGTCTCCAGGCTGCTGGTGGAGCACATCTGGAAGAA
    GATCATGCACACGGATGCCATGATCATCGACATGAGGTCAGTGGCCAGGGGTCAGTGCTTCCTAGCCAGG
    ACGCAGGGCTGCCAGGGGACAGTCAAAGCTATGGGCCACAGCAGGGAAGAAAAGGAACCCTGTGACACAG
    CAGAGGACCTGAGGGGGGCCAGGCCTCCTGCCTATCAGGGCTTCGGCCAGCTAGCCCAGCAGATCTGCTG
    TCATTGCAGGTGGGGCCCAGCACTGGTAGTTTTTGCAAGCTTCTCCAGTGATTCCAATGTGCATTCCAGA
    TTGAGAATTACCCCAGATTTGCCTGGTCATAGGATTCAGTGGGGAGGAGAGGAAGGAGATGTTAAAAACA
    CTGATTCCTGGGCCCCACTCCCCTCTTACTGACTCAGAAGCTCCAGGGGACAGGCCCGATAATCTCTATT
    TGACAGGCATCCCAGGTGATTCTGATGGTCAGTGGTGTGTGAGACAGCCAGGCCCCCCACCTGGGAGTGT
    GCCTCACATCATACAAAATCAACACATGACAACCCTGGTCATATGAATCGTACAGGCAGAATTTGGAAAT
    CACACAGGGAAAATTTAGAAGTTAATCACTATTGTTAACAAAAGAATTCTTTGCATCACCAAATGATTGT
    CAGAAGGATGTCTTCAGCTAGCCACCTCCCCTCTGTTTCTGTAAAAATGTGCCTCATATGTCATGAGTTT
    ACCTCATGGACCAGGGGTAGGAGGTGGATGAGTACCCTCAGGCAGTGGCCAGACCTGGCATCCCATGACT
    CTGGGGTCCATTGGTGGACATGCCCCAGCACCCTCCCTGGGCAGGTTGCCTTCCTCAGACGGGACCCTTC
    CATGCTCCCGTGTTGTCTGAAAGAAGTGGCAGGGGGTGGCAGACCAGAAGCATTCACCCAGCTCCAGTTC
    TCTAGCCCTCAGCGCTCACTCACATGGTTCTTAGTGGTCACTAGGTGGCTCTCGGTCCTGCACCCACTGC
    TTCTCCTCCCTGGGAGATAAAACATTAGCCCTGGCTCCAGTTCTGTGTGTGTTCACAGCCTGAGCTTGAG
    GCTCCTGGGGTCTCTCTGATCATTTTATTCTTTAGAAGTTCTGTTGAGCACCCAAATGACACTCATGCTA
    AGTCTCTTTCTTCTGAATATGCCATTTACACTTTTTAAAGAGGAGATGGCCCCAGCCTGCAAGTGCACTT
    TGCTTAAAGACCCTCCCACCCCTGAGGTTTGTTTGGAGGTTCAGACACTGACATCACAGGCCCCGAACCC
    AGCCAGGCCATCCCAGGCCATCAGTTGGACGAGGCTCCTTAACACATCACTAGCCCCAGTGGGGAGACAG
    GGGCCCAACGAGGTCACACAGTGGGACAAATCTAAATGGCCTGGGAGAAATACAGGCTCCCCTGCTCCCA
    ATGCAGCTCCACAAGCCTGAATATTTCAATACACTAAGTGCCCTGTTAAGACACCTGAACTAAGACAGCT
    GGTAGGTGTCATAAGATTGTCACAGAATGCAACGGGAAAAACAATGTTTCCCAAAATGTGTTCCACTCAT
    AGGAAGATATGGGTGCAGGGGAGCAGTCCATGGTCAATAAATGGGGGAAATTTATCAACAAGTTTCTGAC
    TGCAGGACTTGTCAGGGCCTTTAATATATTAACATGTATTAATTACATAGCAGAAGGAAAGGATAACATA
    TTTGATCACTAAGTTTCTTGTTCTAAAGAGACTAGTACTCTTGGAAATACTCTGGAAAATGCCAACCCAT
    GGAATTCTAAAGGAGGAAGAGGCACTAGACTGAGGCTGCCAAGAATTAGAACCCTCCATGGGACAAAGAT
    CCTGGCCTCCCCGAGGGGCACACAGGGCCTCACTGTGAGCTCAGCCCCTGAACAGGCTCTGCTTCCCATC
    CTTCAGGTTCAACATCGGTGGCCCCACATCCTCCATTCCCATCTTGTGCTCCTACTTCTTTGATGAAGGC
    CCTCCAGTTCTGCTGGACAAGATCTACAGCCGGCCTGATGACTCTGTCAGTGAACTCTGGACACACGCCC
    AGGTTGTAGGTACGTGGAGAAGCTTTCTCCTTTCTGCTGTCATTCTAGAAGCTTCTGGGAAACCAGGGAA
    AGACAGCTTGGGTGTAGGTAAAAGTCATAGTAACCAGAATGTAAGGCCCTGTCCTAGTCCAGGCACTAGA
    TGTGCATGATCTCGAATCCCTGAAAAGCATGTATCACTATGCCCGTTTTCTAGAGGAAAAAAAAGGGGGT
    GTTGACTAGGTCAAATATCTTTTCTAGGGTCATGCAGCTAATAAGTGAAACCCAAAATGTGAATATTAGT
    TTGTCTAATACCAAAATTTCCCCCAGGCTTAGCACCATAATCACCAGCCTGCAGGACAAATGCAGAATTT
    GAAGGATTCTCCCCGCCCCTCACCAACCCCAGTGGGCATTGCCAGTGCTCACAGTACTTGAGCTCTCAAG
    CCACAGTGCCACAAACTTGCCTGGAAAGGTCATGATGCTGATCGGGCTTCTGTTCCCCGCCCTGGGCCCA
    GAGCAGTGGCTATAGGAGCAAAGGCAGGCCCTGAGCTTTACAGAACCATAACTCTCAAAGCCCCATTCCA
    GGGTGGATGGCCTCCATCTATCTTCCCTGCCCAGTGTGTAAGACCAAGGAACTTGTGCTCCTACCCAACA
    AGAAAGGACTGGAGAGACCGATGGGGGTGTGCCTGTGACCAGAGAAACACCCCACCATTTTCATGTCCAT
    GCTTCTGTAATACACAGGCATTTTGCTGTAGCTCCTAGGACATACGTTCAATAATATTACAAGTGTAAAT
    GCAAATCAGAACCAGGTGAATTCTAAATTCAAATAGATGTTCAAGACTGGAAGTTAAAGATAGACTCAAT
    TCTGCAGATAATGAGGCCCCAAAACCGCAAGGTCCAATATGGGAGCCACAAGCCACCTGCGGCCACCAAG
    CATTTGAAATGTGGCTCTCCCAAGTTGAGATGTGCTGGAAGTGTGATGTGCTGGAAGTGTAATGTGCATA
    CCAGATTTTGAAGACATTATGAAAAGAAAACCTCATTAATAATTTTATTTGATTACATTTTGAAAAGAAT
    GTATTTTGGATACATTGGCTTAAACAAAACATGATTAAAATTAACACCATGGGTTTCTTTTTGCTTGCTT
    AACATGGCTACTAGGGAACCTAAAATGACATCTATGGCCAGCATTCTGGCTCACGTTGCATTCCTGTTGG
    ACAGTGCTGTCCTGGAGAGTTGTTCTTATACATCACAAATTGGGCTTTTCTGAGTCCAAAGTGAAAAGGA
    AGTCAGGTCGGTTTAGGTGTTCTCATTATTCATGAAGAGAGAGGATGCTCCTTTCTCAGGAGAGTCAAGC
    CTTTCCTATCACTTGGCATAAAAAGGCCTCGTTGGGAGTTGTCAAGCACTGAAATCCTCGTGATTGGGCA
    TGCATTCTTGTCCCCATTTTACGGATGCAGAAATCAAGGCTCAGAGAAGTCAAGTGGCTCACAAGTGGAC
    ACAAGGACACAGACCTAAACCCCCGGGCCTCCTCCATCACTGCAGGCCCAGGCAGGATAGAGAAGACAGG
    TGCTCCAGGGTCCTGACATGACCCCCATCCTGAAGGGCCTTATGTCTTCCAGGTGAACGCTATGGCTCCA
    AGAAGAGCATGGTCATTCTGACCAGCAGTGTGACGGCCGGCACCGCGGAGGAGTTCACCTATATCATGAA
    GAGGCTGGGCCGGGCCCTGGTCATTGGGGAGGTGACCAGTGGGGGCTGCCAGCCACCACAGACCTACCAC
    GTGGATGACACCAACCTCTACCTCACTATCCCCACGGCCCGTTCTGTGGGGGCCTCGGATGGCAGCTCCT
    GGGAAGGGGTGGGGGTGACACCCCATGTGGTTGTCCCTGCAGAAGAGGCTCTCGCCAGGGCCAAGGAGAT
    GCTCCAGCACAACCAGCTGAGGGTGAAGCGGAGCCCAGGCCTGCAGGACCACCTGTAGGGAAGGGCCCCA
    TAGGCAGAGCCCCAGGGCAGACAGAACCTCTGGGACACACACCAAGGGCACTCCTGCAGGTGGCCCGGCC
    TGAGGTTCCCAGGAGCAGCAAAGGGGCCTGCTGAGCTCTGGTTAGGTTACAGCTGGAGGTGTGTATATAT
    ACACACACACACATGTATATACACATATATATGTGTATGTATATATATGTATATATATATGGCTTTCCAA
    TAACCACCTAAATTTTAACAAAGGTTCCTTCTAAGTGGTAGAACTTGGGGTGGTATTTTTACCTTCCTTC
    TTCATACTTTGCTCTTTTTCTTAAATACTCATTAATGTGCATATATCATTATTTTCAGATGCAGCTATCA
    TTATTCCAAAATACAAAATAAAGAAGATAAAATAAATTATATACCCGAGCCATTA
    
    
  • Protein Sequence : Show Sequence
    >NP_002891.1 retinol-binding protein 3 precursor [Homo sapiens]
    MMREWVLLMSVLLCGLAGPTHLFQPSLVLDMAKVLLDNYCFPENLLGMQEAIQQAIKSHEILSISDPQTL
    ASVLTAGVQSSLNDPRLVISYEPSTPEPPPQVPALTSLSEEELLAWLQRGLRHEVLEGNVGYLRVDSVPG
    QEVLSMMGEFLVAHVWGNLMGTSALVLDLRHCTGGQVSGIPYIISYLHPGNTILHVDTIYNRPSNTTTEI
    WTLPQVLGERYGADKDVVVLTSSQTRGVAEDIAHILKQMRRAIVVGERTGGGALDLRKLRIGESDFFFTV
    PVSRSLGPLGGGSQTWEGSGVLPCVGTPAEQALEKALAILTLRSALPGVVHCLQEVLKDYYTLVDRVPTL
    LQHLASMDFSTVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEA
    IRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVP
    LLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLLTSHRTATAAEEFAFLMQSLG
    WATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFIDNHGEAWLGGGVVPDAIVLAEEALDKAQEVL
    EFHQSLGALVEGTGHLLEAHYARPEVVGQTSALLRAKLAQGAYRTAVDLESLASQLTADLQEVSGDHRLL
    VFHSPGELVVEEAPPPPPAVPSPEELTYLIEALFKTEVLPGQLGYLRFDAMAELETVKAVGPQLVRLVWQ
    QLVDTAALVIDLRYNPGSYSTAIPLLCSYFFEAEPRQHLYSVFDRATSKVTEVWTLPQVAGQRYGSHKDL
    YILMSHTSGSAAEAFAHTMQDLQRATVIGEPTAGGALSVGIYQVGSSPLYASMPTQMAMSATTGKAWDLA
    GVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVA
    LAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIPSPEVFEELIKFSFHTNVLEDNIGYLRFDMF
    GDGELLTQVSRLLVEHIWKKIMHTDAMIIDMRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVS
    ELWTHAQVVGERYGSKKSMVILTSSVTAGTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYL
    TIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDHL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): EAU DNA vaccine IRBP-DNA encoding IRBP
III. Vaccine Information
1. EAU DNA vaccine IRBP-DNA encoding IRBP
a. Vaccine Ontology ID:
VO_0004402
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of IRBP from humans
  • Type: DNA vaccine construction
  • Description: Vector pcDNA3.1 expressed the uveitogenic retinal Ag interphotoreceptor retinoid-binding protein (IRBP) (Silver et al., 2007).
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3.1 (Silver et al., 2007)
g. Immunization Route
Intravenous injection (i.v.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: IRBP-specific CD4+CD25high T cells could be cultured from vaccinated mice and transferred protection to unvaccinated, EAU-challenged recipients. Expression of IRBP in the periphery by DNA vaccination results in tolerance that acts at least in part through induction of IRBP-specific, FoxP3+CD4+CD25+ regulatory T cells (Silver et al., 2007).
  • Efficacy: Vaccinated mice were highly protected from EAU induced by immunization with IRBP for at least 10 weeks after vaccination (Silver et al., 2007).
IV. References
1. Commodaro et al., 2010: Commodaro AG, Peron JP, Lopes CT, Arslanian C, Belfort R Jr, Rizzo LV, Bueno V. Evaluation of experimental autoimmune uveitis in mice treated with FTY720. Investigative ophthalmology & visual science. 2010; 51(5); 2568-2574. [PubMed: 20019358].
2. Silver et al., 2007: Silver PB, Agarwal RK, Su SB, Suffia I, Grajewski RS, Luger D, Chan CC, Mahdi RM, Nickerson JM, Caspi RR. Hydrodynamic vaccination with DNA encoding an immunologically privileged retinal antigen protects from autoimmunity through induction of regulatory T cells. Journal of immunology (Baltimore, Md. : 1950). 2007; 179(8); 5146-5158. [PubMed: 17911600].