VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Hirame rhabdovirus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Introduction
  2. Vaccine Related Pathogen Genes
    1. G glycoprotein (Protective antigen)
    2. N nucleocapsid protein (Protective antigen)
  3. Vaccine Information
    1. H. rhabdovirus DNA Vaccine encoding G
    2. H. rhabdovirus DNA Vaccine encoding N and G
    3. H. rhabdovirus DNA vaccine pHRV-G encoding HIRRV and VHSV G proteins
  4. References
I. General Information
1. NCBI Taxonomy ID:
38142
2. Introduction
Hirame rhabdovirus (HIRRV) is one of the four recognized species within the Novirhabdovirus genus, represented by the type species Infectious Haematopoietic Necrosis (IHNV). HIRRV was first isolated during an outbreak on cultured flounder (Paralichthys olivaceus) and ayu (Plecoglossus altivelis) in Japan. It was also found on other marine fish in Asia, such as stone flounder (Kareius bicoloratus) in China. Furthermore, it was shown to be pathogenic for a range of salmonids species, including rainbow trout, experimentally challenged in freshwater. The major clinical signs of HIRRV infection were congestion of the gonads, focal hemorrhages of the skeletal muscle and fins and ascitic fluid collection (Borzym et al., 2012).
1. G glycoprotein
  • Gene Name : G glycoprotein
  • Sequence Strain (Species/Organism) : Hirame rhabdovirus
  • NCBI Gene ID : 2559534
  • NCBI Protein GI : 34610118
  • Locus Tag : HIRRVgp4
  • Genbank Accession : AF104985
  • Protein Accession : NP_919033
  • Taxonomy ID : 38142
  • Gene Starting Position : 2923
  • Gene Ending Position : 4449
  • Gene Strand (Orientation) : ?
  • Protein Name : glycoprotein
  • Protein pI : 6.67
  • Protein Weight : 53029.85
  • Protein Length : 508
  • DNA Sequence : Show Sequence
    >gi|34610114:2923-4449 Hirame rhabdovirus, complete genome
    CATGGACCCTCGAATAATGTATTACACTGTTCTCCTCACGACAGCTGCCAGAGTCTATGGTCAAACCATC
    AAGCCTGGAGTTGACAGCGTATCCGATCAACCCACCTGGGCGAATCCCCTGTTTACATACCCTGTGGACT
    GTCCTGCGGCTAAGCTATCCAAGGTGAGTCCCTCACAGTTGAGGTGCCCACGCATATTTGATGATGAAAA
    CCGAGGACTCGTTGCCTACCCTGCTGTCATCAGATCCCTATCGGTAGGGAACAATCTTGGGGACATTCAT
    ACTCAGGGGGAATACGTCCACAAGGTCCTTTACCGAACCACATGTTCAACAGGGTTCTTTGGGGGCCAAA
    CCATAGAGAAGGCCCTAGTAGAGATGAAACTGGCCCCCAGGGAGGTGGGAGTGTATGACACCACGACAGC
    CTCAGCACTGTACTTCCCAGCTCCAAGGTGCCAATGGTACACGGACAATGTACATAACGACCTGACATTC
    TACTATACGACCGCCAAGAGTGTCCTTAGAGATCCTTACACCCTGGGATTCCTTGATTCTGATTTTATTG
    AAGGGAAGTGCTCCAAGTCGCCGTGTCAGACCCATTGGTCAAATGTGGTGTGGAAGGGAGACTCGGGAGT
    TGCCGCCTGTGACACGGGGTCTGAGATAAAGGGTCACATATTTGTGGACAAGACCTCCCACCATGTCGTC
    AAGGCAACGAGCTATGGACACCACCCATGGGGACTTCATCGAGCTTGCATGATTACCTTCTGTGGAAAAC
    CATGGATCAGGACAGACCTAGGGGACCTCATCGCAATCGAATACAATGGCGGGGCGACCCTTCTCGCATT
    CCCTGCTTGCAAGGACACCACGGTTGGAATGAGAGGGAGTCTTGACGACTTTGCCTACTTGGATGATCTG
    GTGAAGTCATCTGAAAGTCGGGAGGAATGTCTAGAGGCACATGCGGAGATCATCGCTACCAATAGTGTGA
    CTCCTTACCTGCTATCCAAATTCAGATCTCCCCACCCAGGAATAAACGATGTCTACGCCATGCATGACGG
    GTCCATATACCACGGAAAGTGCATGACCGTTGCCATTGATGAGGTTTCCAAAGATAGACGAACTTATCGT
    GCCCACCAGACCTCAGCTTTCGTAGCATGGGGGCATCCCTTCGGTGATGAATGGGGCGGGTTTCACGGTC
    TTCATGGCAACGATACTCCTGTGATTCCGGATCTTGAGAAATACGTCGCTCAGTACAAGGTGAGCATGAT
    GGACAAGATGGACATTCGCCCCGTTCCGCATCCTAGTGTCCAGATACTCTACAACGACACAGACACCGCA
    GACATCACAATCAGGAAGATAGACTCGTTTGATCTGCAATCACTCAACTGGAGCTTCTGGCCATCATTGT
    CAGCACTGGGAGGGGTTCCAATACTCCTCGCCCTCGTATTCTTTCTGTACTGCTGCATGAACAGAAGACC
    CTCCATGCCTGCAGCACCCCAAGAGATCCCCATGTACCACCTCGCCAGTCGAGGGTA
  • Protein Sequence : Show Sequence
    >gi|34610118|ref|NP_919033.1| glycoprotein [Hirame rhabdovirus]
    MDPRIMYYTVLLTTAARVYGQTIKPGVDSVSDQPTWANPLFTYPVDCPAAKLSKVSPSQLRCPRIFDDEN
    RGLVAYPAVIRSLSVGNNLGDIHTQGEYVHKVLYRTTCSTGFFGGQTIEKALVEMKLAPREVGVYDTTTA
    SALYFPAPRCQWYTDNVHNDLTFYYTTAKSVLRDPYTLGFLDSDFIEGKCSKSPCQTHWSNVVWKGDSGV
    AACDTGSEIKGHIFVDKTSHHVVKATSYGHHPWGLHRACMITFCGKPWIRTDLGDLIAIEYNGGATLLAF
    PACKDTTVGMRGSLDDFAYLDDLVKSSESREECLEAHAEIIATNSVTPYLLSKFRSPHPGINDVYAMHDG
    SIYHGKCMTVAIDEVSKDRRTYRAHQTSAFVAWGHPFGDEWGGFHGLHGNDTPVIPDLEKYVAQYKVSMM
    DKMDIRPVPHPSVQILYNDTDTADITIRKIDSFDLQSLNWSFWPSLSALGGVPILLALVFFLYCCMNRRP
    SMPAAPQEIPMYHLASRG
  • Molecule Role : Protective antigen
  • Related Vaccine(s): H. rhabdovirus DNA Vaccine encoding G , H. rhabdovirus DNA Vaccine encoding N and G , H. rhabdovirus DNA vaccine pHRV-G encoding HIRRV and VHSV G proteins
2. N nucleocapsid protein
  • Gene Name : N nucleocapsid protein
  • Sequence Strain (Species/Organism) : Hirame rhabdovirus
  • NCBI Gene ID : 2559538
  • NCBI Protein GI : 34610115
  • Locus Tag : HIRRVgp1
  • Genbank Accession : AF104985
  • Protein Accession : NP_919030
  • Taxonomy ID : 38142
  • Gene Starting Position : 166
  • Gene Ending Position : 1344
  • Gene Strand (Orientation) : ?
  • Protein Name : nucleocapsid protein
  • Protein pI : 4.48
  • Protein Weight : 39984.35
  • Protein Length : 392
  • DNA Sequence : Show Sequence
    >gi|34610114:166-1344 Hirame rhabdovirus, complete genome
    TATGGCGAACCTTAAGGAAGAATTTGCAGGACTCCGAGGAGTGAAGGGAGGAGCCCTCGAAGACTCTGGC
    ACGGAGTATGATCCCACCAAGATCAACCTGACGCTCTACGGGACAGACAAGCTCTATACCCTGGCGATCA
    TCAAGAGGGCAGTCAGTCAGGTCGGAGGGTCCCAAACCAACAAAGCACTAGGAATCCTTTGTGCTTTTGT
    CACGTCAGAGAACAACCCTGACATGACAGATGCAGCAGTCAAGCTCCTGGTGGACATGAGGTTCAAGGTG
    GACGTGGTGCCCGTGGACGACAGGCTCGGTGACAATCTGGATGACCCCAACTCAAAGCTGGCGGAGGTCC
    TGACGGAAGAGAACATGGTGGACCTGGTGAAAGGCCTTCTGTTCACTTGTGCCCTGATGGTCAAGTACGA
    TGTGGACAAGATGGCCACATACTGCCAGCAGAAGCTGGAGCGACTGGCCAACAGTCAGGGACTCAACGAG
    CTGACCCTGATAAGCACGAGTAGGGCAGTTCTGGCTCGGATTGGGGCAGCGGTAAGACCGGGGCAGAAGT
    TAACCAAGGCCATCTACGGGATCATTCTTATCAACCTGATGGATCCCGCCACTGCTGCCAGGGCAAAGGC
    CCTTTGTGCCATGAGGCTGAGCGGAACCGGAATGACCATGGTGGGTCTATTCAATCAGGCCTCTAAGAAC
    CTTGGAGCTCCACCTGCAGATCTGCTGGAAGATCTCTGCATGAAGTCCATCATCGACTCTGCCAGGAGGA
    TTGTCAAGCTGATGAGGATCGTTGCAGACGTCGAGGACATGACCGCAAAGTATGCCATCATGATGAGCAG
    GATGCTTGGGGATGGGTACTTCAAGTCCTACGGGATCAATGAGAACTCACGGATCACCTGTATCTTGATG
    AACATCAACGAGCAGTACGATGAGGGGACAACCGGAGGACTGGCAGGAGTCAGGGTTTCACCCCCCTTCC
    GAAAGCTGGCAACCGAGATTGCTCGCCTTCTGGTCAAAAAGTATGACGGGAACGGATCTGCCGGGCCAGG
    TGCCTCAGATCTTGTCCGCCAGGCCGAGCAGGCAGCGCAAGAGACCGAGGGCGAGGATGATAAGTACGAT
    GAGGAGGGCGAGGAAGACGGAGGGGAGGGAGAGGGGGGAGAGGACGAAGAGTACTACTG
  • Protein Sequence : Show Sequence
    >gi|34610115|ref|NP_919030.1| nucleocapsid protein [Hirame rhabdovirus]
    MANLKEEFAGLRGVKGGALEDSGTEYDPTKINLTLYGTDKLYTLAIIKRAVSQVGGSQTNKALGILCAFV
    TSENNPDMTDAAVKLLVDMRFKVDVVPVDDRLGDNLDDPNSKLAEVLTEENMVDLVKGLLFTCALMVKYD
    VDKMATYCQQKLERLANSQGLNELTLISTSRAVLARIGAAVRPGQKLTKAIYGIILINLMDPATAARAKA
    LCAMRLSGTGMTMVGLFNQASKNLGAPPADLLEDLCMKSIIDSARRIVKLMRIVADVEDMTAKYAIMMSR
    MLGDGYFKSYGINENSRITCILMNINEQYDEGTTGGLAGVRVSPPFRKLATEIARLLVKKYDGNGSAGPG
    ASDLVRQAEQAAQETEGEDDKYDEEGEEDGGEGEGGEDEEYY
  • Molecule Role : Protective antigen
  • Related Vaccine(s): H. rhabdovirus DNA Vaccine encoding N and G
III. Vaccine Information
1. H. rhabdovirus DNA Vaccine encoding G
a. Vaccine Ontology ID:
VO_0004583
b. Type:
Live, attenuated vaccine
c. Status:
Licensed
d. Gene Engineering of G glycoprotein
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Immunization Route
Intramuscular injection (i.m.)
f. Fish Response
  • Vaccination Protocol: Five groups of forty flounder fry with a mean weight of 3 g were prepared for injection with pcDNA-G, pcDNA-N, a pcDNA-G and pcDNA-N mixture, pcDNA3.1(+) vector, or PBS (Seo et al., 2006).
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: Both cellular and humoral immune responses are involved in the protection of fish immunized with DNA vaccine. Induction of specific antibody response has been observed from rainbow trout immunized with rhabdovirus G protein constructs. However, despite high levels of protection, neutralizing antibodies could not be detected in all vaccinated fish at the time of challenge, or survivors of the challenge (Seo et al., 2006).
  • Challenge Protocol: At 21 days post vaccination, flounder fry injected with different DNA vaccines were challenged by immersion in water containing 1.2 × 104 TCID ml−1 HIRRV (Seo et al., 2006).
  • Efficacy: Groups injected with the pcDNA-G showed only 5% cumulative mortality. Control groups injected with plasmid only or PBS only showed at least 95% mortality. These results demonstrated the protective effect of this DNA vaccine against HIRRV infection (Seo et al., 2006).
2. H. rhabdovirus DNA Vaccine encoding N and G
a. Vaccine Ontology ID:
VO_0004567
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of N nucleocapsid protein
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Gene Engineering of G glycoprotein
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA-G and pcDNA-N (Seo et al., 2006)
g. Immunization Route
Intramuscular injection (i.m.)
h. Baboon Response
  • Vaccination Protocol: Five groups of forty flounder fry with a mean weight of 3 g were prepared for injection with pcDNA-G, pcDNA-N, a pcDNA-G and pcDNA-N mixture, pcDNA3.1(+) vector, or PBS (Seo et al., 2006).
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: Both cellular and humoral immune responses are involved in the protection of fish immunized with DNA vaccine. Induction of specific antibody response has been observed from rainbow trout immunized with rhabdovirus G protein constructs. However, despite high levels of protection, neutralizing antibodies could not be detected in all vaccinated fish at the time of challenge, or survivors of the challenge (Seo et al., 2006).
  • Challenge Protocol: At 21 days post vaccination, flounder fry injected with different DNA vaccines were challenged by immersion in water containing 1.2 × 104 TCID ml−1 HIRRV (Seo et al., 2006).
  • Efficacy: Groups injected with the mixed pcDNA-N+pcDNA-G vaccine showed only 2.5% cumulative mortality. Control groups injected with plasmid only or PBS only showed at least 95% mortality. These results demonstrated the protective effect of this DNA vaccine against HIRRV infection (Seo et al., 2006).
3. H. rhabdovirus DNA vaccine pHRV-G encoding HIRRV and VHSV G proteins
a. Vaccine Ontology ID:
VO_0004419
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of G glycoprotein
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
pCI-neo (Yasuike et al., 2007)
f. Immunization Route
Intramuscular injection (i.m.)
g. Fish Response
  • Immune Response: A type I IFN system was stimulated by vaccination with pHRV-G in the Japanese flounder, which contributes not only to innate immunity but also to acquired immunity. In addition, type I IFN plays a role in Th1 polarization of the immune response induced by DNA vaccination (Yasuike et al., 2007).
  • Efficacy: Fourteen days after the HIRRV challenge, cumulative mortalities of the fish injected with pHRV-G was 13%, as compared to the cumulative mortalities of the control group which was at 98%. This confirmed previous protection studies which demonstrated the efficacy of this vaccine (Yasuike et al., 2007).
IV. References
1. Borzym et al., 2012: First detection of Hirame rhabdovirus (HIRRV) in Europe [http://orbit.dtu.dk/fedora/objects/orbit:112698/datastreams/file_9708708/content]
2. Seo et al., 2006: Seo JY, Kim KH, Kim SG, Oh MJ, Nam SW, Kim YT, Choi TJ. Protection of flounder against hirame rhabdovirus (HIRRV) with a DNA vaccine containing the glycoprotein gene. Vaccine. 2006; 24(7); 1009-1015. [PubMed: 16176849].
3. Yasuike et al., 2007: Yasuike M, Kondo H, Hirono I, Aoki T. Difference in Japanese flounder, Paralichthys olivaceus gene expression profile following hirame rhabdovirus (HIRRV) G and N protein DNA vaccination. Fish & shellfish immunology. 2007; 23(3); 531-541. [PubMed: 17449275].