VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Schistosoma japonicum

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. FABP (Protective antigen)
    2. Il12a (Protective antigen)
    3. Paramyosin (Protective antigen)
    4. Sj23 (Protective antigen)
    5. TPI (Protective antigen)
  3. Vaccine Information
    1. Chinese S. japonicum DNA vaccine pCMV-Sjc97 encoding paramyosin
    2. Chinese S. japonicum DNA vaccine pVAX/SjFABP encoding FABP
    3. Chinese S. japonicum DNA vaccine pVIVO2-IL12-Sj23 encoding Sj23 and IL-12
    4. Chinese S. japonicum DNA vaccine SjC23
    5. Chinese S. japonicum DNA vaccine SjC23-Hsp70
    6. Chinese S. japonicum DNA vaccine SjCTPI
    7. Chinese S. japonicum DNA vaccine SjCTPI-Hsp70
    8. rAdV-SjTPI.opt
    9. S. gordonii -M6-Sj-F1
  4. References
I. General Information
1. NCBI Taxonomy ID:
6182
2. Disease:
Schistosomiasis
3. Introduction
Schistosoma japonica remains endemic in seven provinces in China. Human infection is acquired during the course of domestic or occupational activities, in particular fishing and farming. Acute infection may result in fever, weakness, diarrhoea, abdominal pain and hepatomegaly. Chronic disease involves granuloma formation, tissue inflammation, liver lesions and fibrosis, which may persist after infection has been cleared. Schistosoma japonicum is also known to infect 45 species of animals, of which water buffaloes are especially important for transmission (Balen et al., 2007).
1. FABP
  • Gene Name : FABP
  • Sequence Strain (Species/Organism) : Schistosoma japonicum
  • NCBI Protein GI : 349804
  • Other Database IDs : CDD:207329
  • Taxonomy ID : 6182
  • Gene Strand (Orientation) : ?
  • Protein Name : fatty acid binding protein
  • Protein Length : 132
  • Protein Note : Lipocalin / cytosolic fatty-acid binding protein family; cl01150
  • Protein Sequence : Show Sequence
    >gi|349804|gb|AAA64426.1| fatty acid binding protein [Schistosoma japonicum]
    MSSFLGKWKLSESHNFDAVMSKLGVSWATRQIGNTVTPTVTFTMDGDTMTMLTESTFKNLSVTFKFGEEF
    DEKTSDGRSVKSVVTKDSESKITHTQKDSKNTTVIVREIVGDTMKTTVTVDDVTAIRNYKRL
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Chinese S. japonicum DNA vaccine pVAX/SjFABP encoding FABP
2. Il12a
  • Gene Name : Il12a
  • Sequence Strain (Species/Organism) : Mus musculus
  • NCBI Gene ID : 16159
  • NCBI Protein GI : 226874945
  • Genbank Accession : AC121306
  • Protein Accession : NP_001152896
  • Taxonomy ID : 10090
  • Chromosome No : 3
  • Gene Starting Position : 68690643
  • Gene Ending Position : 68698546
  • Gene Strand (Orientation) : +
  • Protein Name : transcript variant 1
  • Protein pI : 8.33
  • Protein Weight : 25111.9
  • Protein Length : 236
  • Protein Note : Also known as p35; Ll12a; Il-12a; IL-12p35
  • DNA Sequence : Show Sequence
    >gi|372099107:68690643-68698546 Mus musculus strain C57BL/6J chromosome 3, GRCm38 C57BL/6J
    CTGCCACCTACTCCCTTGGATCTGAGCTGGACCCTTGCATCTGGCGTCTACACTGCTGCTGAAATCTTCT
    CACCGTGCACATCCAAGGATATCTCTATGGTAAAAGTCCAGAAAGGCTAAAGATGTTGTCCACAATCTCT
    CGGCAATGACCAGATATATCCCCACCAGTATCACAACTTGCAACGCGCTCCGTTCCCATCTGCCCTCTGC
    CTCCCTACTGTGTTGATTCCCATTTCCAAAACTAGCTCAGAATGCATCCCACTGGCAGCCAGGCAATGCC
    TTCTTGCAGATCTGGAGGCTTCAGGAGCCTTTGCTGCCTCTTAGGCTCCTGCAGAGAGATGGCCTTGCTC
    TCTCTGGGCCCTTTTCCCCCAAGATGCTGTGCAGTCGTCTCACTAAATCAAAACTGCCAGAACTGAGTTT
    TAAGCGATATATAGCCACCACATCTATTTTGTTCCTTTATACTTTCAAAGTAGGACAGATTCGCAAAATA
    CATTGAGTCAGACTCAGTGTCCACGATGGAGAGACGAGTGGGTAGCTTGTGCTTCTTTAGAAGGGGCACT
    GGGCAGCGTGTTAGGGCTAGGGGGTAGTGGGGCAGGACAGACCTGTCCCGGGACAAGAGTGGCTACTCGC
    AGGCCGGTTTTGCTTTCGCTCTGAGTGTGGTGGGCGGTGGGACGGTCCCGAATCTCCTCAAACGGGCACT
    CCGAGAGTTAATTCGAAAGCGCCACCAGCCTTGGGGGCGATCGACGCACTTGTCCTTGAGATGTAGAGAC
    AGAGAGAGAAAGCAAGAGACACAGTCCTGGGAAAGTCCTGCCGGCTATCCAGACAATTATAAAAATGTGT
    CTCCCAAGGTCAGCGTTCCAACAGCCTCACCCTCGGCATCCAGCAGCTCCTCTCAGTGCCGGTCCAGCAT
    GTGTCAATCACGCTGTAAGTACCTGAGGGCCGGGACCAGGGTGACTTGATGAGAGGAGAAGGCTTGAGAA
    AGAACAGACAGAAGCCCTGGACCCATTAAGGGAGACTAAAGGGCTGCCAGCAACTGCAGGCCAAGGGAAG
    GAAGAGGGGAAAGATGGTCGTGCTAGATTGCGCTGCACCGAGCATGGTCTCATTATAGAACAACCCTGGG
    GGCTACGGCTATGCCCGTTTCACAGAAGAGAACTAAAGCCCAGCCTTGAAACCAATGTAAGGAAAATGCA
    GGTCTCAGGCAGTCCCCAAACAAGATCTGGGAGGTCTTGCTTCATCTGTCAGCCCCGGGGAAGGGCTTAA
    ATTATGTGTGGAGGGAGGTCAGTACCCAGAATGGATGGAAAAAATTGCCAGAATGGCTGAAGAAAGAGGC
    AGGTCAAAACCAAGTTGACAAGCTCCACCTGCCCTTTGTTTCCCTTCCAGACCTCCTCTTTTTGGCCACC
    CTTGCCCTCCTAAACCACCTCAGTTTGGCCAGGGTCATTCCAGTCTCTGGACCTGCCAGGTGTCTTAGCC
    AGTCCCGAAACCTGCTGAAGACCACAGATGACATGGTGAAGACGGTGAGTTTCTCCTGTCCTTCTGGCTT
    CAAAGTTCCGCTGTTGACATGACTTCTAACCTATCTGGTATCTGCTGGGAAGTTTATGGTATCTGGCAGG
    AACCGTAGAGGGTTTCAAGACTTCTAAATATAATCTAAAGGAAACTGTGTCTCTAGAGAAAGGAAGAATG
    GTAATAAATTGTAACGGCATCGGTTTAGGCTGTGTCTACACAGAGGAAAGTGGGGACTTGCAATGTCCCT
    CCCAGCCTGCCTGCCTGTGTGACACAGTGTCAGGTGCTCCCTGCTTCTGCTTCAGGGCAGGTGGAACAGG
    GAGACAGTCTCTAGGTACACTCTCTGTGCTTCACAAGCCATAGAGATGAATTAGATTGTCTCTCCCCCTG
    CTCACCAGTGTCCAGCACTGTGATGCAGTCCCTTGTCGGATGGACACATGTCAGGGAGGACTCAGACATC
    AGATAGCAAGCAGGTCCAGCCTCCAGTTTTCTGGGGCAAGTGTGATCCAGTTTTAGTCACGGCTCCACTC
    ATTTTTCTCAGGTTTCATGTTTGAATGCAAAATAGCCTTTTCCGTTGTAAAATTGCCACGGTTTCCTCTC
    GCTTTGGGGACAAAGCTACAGCAAAATGCTAATGTGTTTGAGATATCCTGCAGCTGCTAGGGCTGGAGAT
    CCAGTAGAATTCTGGCTTAATTATGAATGGGTCTCCCGGGTTCTATCCCCCAACAGAGCGTGCGTTCATA
    AGCACCTGGGAACAGAGGAGGGAAGGAGGGAAACTCTGTCTTCCTGTTTTGTTTTTAAATCTTTCTTGAG
    GATCTTCTAGCTTGTTGTCTTATGGCTATCCCAACATAAGCTCCGCTCCACAAGCCCTTCTTGGTGAATT
    TTCTTTCTTTCCTTCCCGTCTTGCATAACGTGCTGCTGGCTGTTCCTCCAAGCTCAGTCTTAATTGAGTG
    GGGTTCCCAGGAGGGAGAGATGGCTCTGTGGTTAAGAGAGCTGGCTGCTCTTCCAGAGGTCCAGAGTTTC
    CACACCCTCATGGTGGCTCACAATCATGGTAACTCTGATCATAGGGAACCTGTCGTTTTCTCTGTGCCTC
    TGTGGGCACTGAGCACATGCCACACAGACATCCATGCAGGCAGAACACTCTTGGCCATGAAACCTTAAAA
    TGAAGGAGAAACCTTACGAGAGGTTCCCTAAGGAATCCCTGCAGAAGGGAGAGATTGTTTTCCTAAGATG
    AGGTTTGGTGTGGAGGGGATGAGGTATTCAAAGTTAACTAGCCGCTCCTCACTCCTCTGCTGCCAAATAC
    CAGCACTGGGCTTCGAGACACAATAGAATTCGACCTTGTTTTCGTTTGGGTCACTATTGCTCTCTAGTTG
    AACACGGAATCCACGGGGGCACATTGCTGTCTGTCCTTTGTCACACCCCAGGACCACAGCTGCATGGAAA
    AGTCATCGCAGGCTTCAGTCAGAGAGCTGTTGACTTCCTAATATGTTGTGTAATTCTGTTCAGTGGTGCT
    TTCCAGCACACCAGGGAATAAGAGACAGTCCCCGCGTATGTAAATTAAAGCTCAACTAGTATTTAGGGCT
    TGCAAGTTTGTTACAGCCATCAAGCTGTGACTTTAACAGTTTCCTCTTTAGAAGTTAAACTTGAAAAAAA
    ATAGAGGGAGAGAGAGATTCACAGGGCACAGCTGCTTGGAAAAAGGAAAAGCCACAGGACTCACCAGAAG
    CAAGCAGCACAGTGTGGCACTGATGCTGATGAGTACAGCCTGCTGCACCCCAGTGTTCACATGGTGAAAA
    AAATACCCTGCTGGCGGACAGCCTAGGCAAAGGGGGAGGAGAGTAGGGAGAGCGTGCGGGAGGTTGGGTT
    TCTTAGCTTATGAAGAGCCTGAGTTTCCTACAGGCCAAAGAGATGACGGTTCAGAGTGGCCAGCCTAGGC
    TCTGCTGATCCACTGCGATGCAGGTCTCAGAGGGAACCAGCTGTCTTGCTGAGAGATTCACCTCAGCTTC
    TCCTTATGTTTTTCCCAGGCCAGAGAAAAACTGAAACATTATTCCTGCACTGCTGAAGACATCGATCATG
    AAGACATCACACGGGACCAAACCAGCACATTGAAGACCTGTTTACCACTGGAACTACACAAGGTATGGAG
    GACCCCCACCCAAAAAACAACAACAACAACAACAAAAAACACAATTAAGAGCCGTGCAGCCAACCTCAGC
    TGTCTCCAGATACTTACTTGTAGCTATCAAACGTGAGAGTTTTGAAGAAAAAAAAAAAAGTCAACAACCA
    TACAAATACTTCTACAAGCTGAAGGATATACTCGGTAACTAGGAGGTGGCTATGGTGGTATAGACCTTTA
    ATTCCAGCACTTGATGGATAGAGGAAGGCCGGCTCCTGTTAAGTTAGAGGCCAGTCAGGGATACACAGCA
    AGATTTCATCTTTAAAAAGAAAGGGGGTGGTGTGGCGGGTGAAGCTTACTTATTGAAGTGCTCATGTCAC
    AAGCCTGGGGACCTAAGTTCCCATCCCCAGCACCCATGTAGGAGCTGGGTGTGATGGTTTCACATGCAGA
    GACAGGAGGATACCTGGGCCAGCTAGTCTAGCCGAATCCATGAGCTGCAGGCCCAGTGAGAGAACCTGTA
    TCAGAAAACAAGAAAGTCAGGAGAGCGGCTGAGAAAGACCCCAAAGATCATCCTCCGATTTCCACGAGTA
    CATGCACCTGCACACACGTGCACACAGGAATCCTATACATAGCCACCCAAAAGCAGTTATGATGGTGAAG
    TTTCTTTTACTGGAATGAAAAGTTAGTTTGAGAAAAAAATATCAGAGAGATTTATATTAAGAGTGAATGG
    GTGGGGGGTATGCATGCCTTTAATCTCAGCACTTGATAGGCAGAGGCAGATGGATCTCTGTGAGTTCAAG
    GCCGGCCTGGTCTACAGAGTAAGTTCCAGGACAGCCAGTGCTACAATAGAAACAGGTGATGGTGATGATG
    GTGATGATGGCGGTGATGATGATGATGATGACGAAGACAAACTCCTCGGTTTATGATTTTCTTCTAGAAC
    GAGAGTTGCCTGGCTACTAGAGAGACTTCTTCCACAACAGTAAGTAAGCACTCTAAGGGTTCCTTCCCCA
    TGACGGATTCATAACACTGATGCCTGGTCATTCTTTCTCTAGAGAGGGAGCTGCCTGCCCCCACAGAAGA
    CGTCTTTGATGATGGTAAGCCACATCACTTTTCTGAAATGCAGCAGGGTCCTGTAGTTCCAGCCCATCTC
    AATGATTCCTTGCCCATTGTGTCCTGCGCTCTAGACCCTGTGCCTTGGTAGCATCTATGAGGACTTGAAG
    ATGTACCAGACAGAGTTCCAGGCCATCAACGCAGCACTTCAGAATCACAACCATCAGCAGATCATTCTAG
    ACAAGGGCATGCTGGTGGCCATCGATGAGCTGATGCAGGTAAGCCTTCCTCCTATCAGCCAGCGCTCCTT
    TTCCATGGTGAAGAGAGGTCCTTTATTAGATATGATAAAATCAGCACAGCTTGGGTTGGGAGAGACCTGA
    ACACCCCCACCCCACCCCACACCCTCATCCCCCAACCATGAAAGGCCTTGCAAGGTTACATTTGCTTAGA
    GAGCCTTGAGGGGGCCTCTACAATAAGGGCAAATGCAAGCAGCCTTCTACTTGTTGACTCATGATACAAA
    TCAGGCACTTTTCAAATGCTTCTTCTCATACCATCCCCACAACAAGCAAATAAGGTCTCTACAGAGGAGG
    AAACTGAAGCTTAAGAGGATGAACGAGGGTTCCCTACAAAAGGGTTTTTTGTTGTTTGGTTTGGTTTGGT
    TTGGTTTGGTTTGGTTTGGTTTTTCCGAGACAGGGTTTCTCTGTATAGCCCTGGCTGTCCTGGAACTCAC
    TTTGTAGATCAGGCTGGCCTCGAACTCAGAACTCCACCTGCCTCTGCCTCCCAAGTGCTGGGATTAAAGG
    TGTGCGCCACCATTGCCCAGCTTATTGTTGTTTTAAATACATTCTTTTCTTAAAGGTTCAAGATTAGGAC
    TGGAGAGACAGTCCGATGATTAAGAGGACTTGAGTTTGGCCTGGGGCTCCTATGTAACAAACAGGGTGTG
    GTCCTGAACTGCTCTCTAACTCCAGAGAGTGGAGACAGGAGGCCTATGGAGGCTTTCTTGCTGCAAGTTT
    AGCCATGAAATCTCCAGGTTCAGGGAGAAAGCATGCCTCAAAGAAATAAGATGGAGAGTCACGTGATCTC
    TTCTCTGGCTTCTGCATGGTGTAGGCACAGATATGCACATGTTTGAGTGCATACAATACAGGCAAACATA
    CACGTGTCCTTTTTAAAATGTATAGGATGGACATTCTAGGGGCTGCACACATATTCAAATATTACTAGGG
    GAAGCACTTGGGGCTGGTGTCCAAGTATAATCTATTTTGAACCAAAATGTGACCAAAATGAAAAGTGGTC
    TTACATCTAGGTAATTACAGTGTTAGGTATCCGTGGGAACTTTGCTGTACCACCAGTAACACAAAGCACA
    GGAGTGTGCACACCAGAGACAAGCACCTTGGCAACCAAGGCGTGGGATGAACATATGTTCAGAAGTCACT
    GCCTGGAAAGCAATTGTTTTTCATTTCATACATACTGTCTTGCACAGGGTTTCTATGTCTTAGATAAAAT
    ATCATGACGGAAAGCAAGTTGGGGAGGAAAGGGTTTATTTCATCTTGTAGAGTGTAGTGAGTCTATTACC
    CAGGGAAGTGGAGGCAGAAGCTGATGCTGGAGAGGACTCCTGGTGACTGGAGTGCTCCACATGACTTGCT
    CAGTGTGCTTTGTATAGCACCCAGGACCACCAGGCTAGGGTGAGCTGGTGCCTCCCACATCAACTGTCAA
    TCAAGAAAATCACCAGAGGCTTGCCCACTGGCCAATCTGGCTGGAGGTGTTTTTCTCAATGACCACAGGC
    TTGTGTAGAGTTAACATAAAAGCACCCAGGACATTACATATTGCCAGATGACTCCTTTGAAAGACAGTGA
    AGTTTATGCAGGTCAAACAACCTATCATGTAGAGATTTGTAATGGATATTGCATGAACAAGGCCAGAAGT
    CAGGTGATTTGGATAGTAGGAAGAGGTCTACCAGGGACCAGCCAACTATGCTGACAGGGTTAACTCTTGT
    CAGCCTGTTTGTAAAATAAGATGACTTTAAATAGCCTATGTCTCTCTTGAGATTTTTGTGAGGAGCAAGC
    AAAAATCTTAAACATCACAGAAACCTAAGTTCTTATTCTATGTTATGAAATCAAAGGATCGAGTGGGGAA
    ACACGGTACTGGCTTGTTTATCTACCACAAATAGCGTTTCTATCAGAGATAGGTCTGTTGTTGATAATAA
    GCTCTAATCCATAGATCCTACTTACCCTCCAACTCCCTCCTCTAAAAGAACAGGACTTCTTAACATAATT
    TATAAAAATTAATTAGCTATTGCTGCAGGTGCTACCTCATAGACTCACACCTTCTGAGAGATCAGCTCTA
    ATGACAATTTCTTTCTGGAAAATTTAGGGGTCTTGTCAGAGATCATTAAAAACATAGGTATATGCTCACA
    AAAGAGTATTTCTTCCCTCTTTTCCTGCAGGAACACAGCAGGAGTAGATGTGAAATGGGTCTAGGAGTGT
    GATGAGGGGCTAGGTTGCAGGCCCTGGACTTTGCATTGACTGTCTCCCATTTTGCAGACAAACATTCTAA
    TTTTTAAATTGTGCATATGCTATGCTTGGTGTTTCTTTCTAGTCTCTGAATCATAATGGCGAGACTCTGC
    GCCAGAAACCTCCTGTGGGAGAAGCAGACCCTTACAGAGTGAAAATGAAGCTCTGCATCCTGCTTCACGC
    CTTCAGCACCCGCGTCGTGACCATCAACAGGGTGATGGGCTATCTGAGCTCCGCCTGAAAGGCTCAAGGC
    CCTCTGCCACAGCGCCCTCCTCACACAGATAGGAAACAAAGAAAGATTCATAAGAGTCAGGTGGTCTTGG
    CCTGGTGGGCCTTAAGCTCCTTCAGGAATCTGTTCTCCCATCACATCTCATCTCCCCAAAGGTGGCACAG
    CTACCTCAGCATGGTCCCCTCCATCGCTTCTCTCATATTCACTATACAAGTTGTTTGTAAGTTTTCATCA
    AAATATTGTTAAGGGGCGAAGACGTCCTCCCCTCAATGTGTTAGCAGAAGAGCAAGAACTGATAAGCTAT
    TGTTTTTGTGCCAAAGTGTTTATGAAAACACTCAGTCACCCCTTATTTAAAAATATTTATTGCTATATTT
    TATACTCATGAAAGTACATGAGCCTATTTATATTTATTTATTTTCTATTTATTATAATATTTCTTATCAG
    ATGAATTTGAAACATTTTGAAACATACCTTATTTTGTGGTTCTAATAAAGTAATGTTATCACTT
  • Protein Sequence : Show Sequence
    >gi|226874945|ref|NP_001152896.1| interleukin-12 subunit alpha isoform 1 [Mus musculus]
    MVSVPTASPSASSSSSQCRSSMCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQSRNLLKTTDDMVK
    TAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLC
    LGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKM
    KLCILLHAFSTRVVTINRVMGYLSSA
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Chinese S. japonicum DNA vaccine pVIVO2-IL12-Sj23 encoding Sj23 and IL-12
3. Paramyosin
  • Gene Name : Paramyosin
  • Sequence Strain (Species/Organism) : Schistosoma japonicum
  • NCBI Protein GI : 4761226
  • Other Database IDs : CDD:144972
  • Taxonomy ID : 6182
  • Gene Strand (Orientation) : ?
  • Protein Name : paramyosin
  • Protein Length : 866
  • Protein Note : Myosin tail; pfam01576
  • Protein Sequence : Show Sequence
    >gi|4761226|gb|AAD29285.1|AF113971_1 paramyosin [Schistosoma japonicum]
    MMNHDTESHVKISRTIYRGVSPSTTRLESRVRELEDILDLERDARVRAERHAADLSYQVDALSERLDEAG
    GSTTQTQELLKRREMEINKLRKDLENANASLELAETSMRRRHQTALNELSLEVENLQKQKGKAEKDKSHL
    IMEVDNVLGQLDGALKAKQSAESKLEGLDSQLNRLKTLTDDLQRQLTELNNAKSRLTSENFELLHINQDY
    EAQILNYSKAKSSLESQVDDLKRSLDDESRNRFNLQAQLTSLQMDYDNLQAKYDEESEEASNLRNQVSKF
    NADIAALKSKFERELMSKTEEFEEMKRKLTMRITELEDVAERERLKAVSLEKLKTKLTLEIKDLQSEIES
    LSLENGELIRRAKSAESLASELQRRVDELTIEVNTLTSQNNQLESENMRLKSLVNDLTDKNNALERENRQ
    MNDQVKELKSSLRDANRRLTDLEALRSQLEAERDNLASALHDAEEALRDMDQKYQASQAALNHLKSEMEQ
    RLRERDEELESLRKSTTRTIEELTVTITEMEVKYKSELSRLKKRYESSIADLEIQLDATNKANANLMKEN
    KNLAQRIKDLETFLDDERRLREAAENNLQITEHKRIQLANEVEELRSAMENLERLRKHAETELEETQSRV
    SELTIQVNTLSNDKRRLEGDIGVMQADMDDAINAKQAAEDRATRLNNEVLRLADELRQEQENYKHAEALR
    KQLEIEIREITVKLEEAEAYATREGRRMVQKLQARVRELEAEFDGESRRCKDALAQARKFERQYKELQTQ
    AEDDRRMVLELQDLLDKTQMKMKAYKRQLEEMEEVSQITMNKYRKAQQQIEEAEHRADMAERTVTVRRVG
    PGGRAVSVARELSVTSNRGMRATSMM
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Chinese S. japonicum DNA vaccine pCMV-Sjc97 encoding paramyosin
4. Sj23
5. TPI
  • Gene Name : TPI
  • Sequence Strain (Species/Organism) : Schistosoma japonicum
  • NCBI Protein GI : 2501312
  • Other Database IDs : CDD:73362
  • Taxonomy ID : 6182
  • Gene Strand (Orientation) : ?
  • Protein Name : Triosephosphate isomerase
  • Protein Length : 252
  • Protein Note : TIM; Triose-phosphate isomerase
  • Protein Sequence : Show Sequence
    >gi|2501312|sp|Q27775.1|TPIS_SCHJA RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: Full=Triose-phosphate isomerase
    MSGSRKFFVGGNWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFVYLNEVRQSLAKEIHVAAQNCYKV
    PKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAEGLSVVACIGETLSERESGKT
    EEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVHNFLRKWFKTNTPSGVDQQIRI
    IYGGSVTAANCKELAQQHDVDGFLVGGASLKPEFIDICKARQ
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Chinese S. japonicum DNA vaccine SjCTPI , Chinese S. japonicum DNA vaccine SjCTPI-Hsp70
III. Vaccine Information
1. Chinese S. japonicum DNA vaccine pCMV-Sjc97 encoding paramyosin
a. Vaccine Ontology ID:
VO_0004456
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of Paramyosin
  • Type: DNA vaccine construction
  • Description: Vector pcDNA vector/Amp expressed the full-length cDNA encoding paramyosin of Chinese S. japonicum (Sjc97) (Zhou et al., 2000).
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA1/Amp (Zhou et al., 2000)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: In three separate experiments, pCMV-Sjc97, inoculated intramuscularly three times at doses of 100 or 200 μg per C57BL/6 mouse, was found to provide significant worm reduction rates. In addition, there was a substantial reduction in the number of eggs present in the livers and spleens of the pCMV-Sjc97 immunized group when compared with the pCMV blank vector control groups. Therefore, preliminary results suggest pCMV-Sjc97 can confer protective immunity in C57BL/6 mice (Zhou et al., 2000).
2. Chinese S. japonicum DNA vaccine pVAX/SjFABP encoding FABP
a. Vaccine Ontology ID:
VO_0004457
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of FABP
  • Type: DNA vaccine construction
  • Description: Vector pVAX1 expressed Schistosoma japonicum 14 kDa fatty acid binding protein (SjFABP) (Wei et al., 2009).
  • Detailed Gene Information: Click here.
f. Vector:
pVAX1 (Wei et al., 2009)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: The mice inoculated intramuscularly with pVAX/SjFABP showed significant worm reduction rate of 22.94% (P < 0.05) and egg reduction rate of 30.23% when compared with the pVAX1 control group. The addition of the pVAX/mIL-18 plasmids dramatically enhanced protection with worm reduction rate of 36.92% and egg reduction rate of 43.23% (P < 0.05), compared to the pVAX/SjFABP group (Wei et al., 2009).
3. Chinese S. japonicum DNA vaccine pVIVO2-IL12-Sj23 encoding Sj23 and IL-12
a. Vaccine Ontology ID:
VO_0004460
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of Sj23
  • Type: DNA vaccine construction
  • Description: Vector pVIVO2 co-expressed S. japonicum integral membrane protein Sj23 and murine cytokine IL-12 (Gan et al., 2004).
  • Detailed Gene Information: Click here.
f. Gene Engineering of Il12a
  • Type: DNA vaccine construction
  • Description: Vector pVIVO2 co-expressed S. japonicum integral membrane protein Sj23 and murine cytokine IL-12 (Gan et al., 2004).
  • Detailed Gene Information: Click here.
g. Vector:
pVIVO2 (Gan et al., 2004)
h. Immunization Route
Intramuscular injection (i.m.)
i. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: A 45.53% reduction in worm burden as well as a 58.35% egg reduction rate were found in mice vaccinated with pVIVO2-IL12-Sj23. The multivalent DNA vaccine pVIVO2-IL12-Sj23 induced stronger protection than the monovalent vaccine pVIVO2-Sj23 (P<0.05) (Gan et al., 2004).
4. Chinese S. japonicum DNA vaccine SjC23
a. Vaccine Ontology ID:
VO_0004512
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Water buffalo
e. Gene Engineering of Sj23
f. Vector:
pVAX1 (Da'dara et al., 2008)
g. Immunization Route
Intramuscular injection (i.m.)
h. Water buffalo Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: This vaccine reduced worm burdens by 45.5% and fecal miracidial hatching by 47.4% after challenge (Da'dara et al., 2008).
5. Chinese S. japonicum DNA vaccine SjC23-Hsp70
a. Vaccine Ontology ID:
VO_0004511
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Water buffalo
e. Gene Engineering of Sj23
  • Type: DNA vaccine construction
  • Description: pVAX1 expressed SjC23 and bovine heat shock protein 70 (Da'dara et al., 2008).
  • Detailed Gene Information: Click here.
f. Vector:
pVAX1 (Da'dara et al., 2008)
g. Immunization Route
Intramuscular injection (i.m.)
h. Water buffalo Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Worm burdens were reduced by 50.9% and fecal miracidial hatching by 52.0% after challenge (Da'dara et al., 2008).
6. Chinese S. japonicum DNA vaccine SjCTPI
a. Vaccine Ontology ID:
VO_0004458
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Water buffalo
e. Gene Engineering of TPI
  • Type: DNA vaccine construction
  • Description: This DNA vaccine expressed triose-phosphate isomerase (SjCTPI) (Da'dara et al., 2008).
  • Detailed Gene Information: Click here.
f. Immunization Route
Intramuscular injection (i.m.)
g. Water buffalo Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Worm burdens were reduced by 41.5% and fecal miracidial hatching were reduced by 33.2% (Da'dara et al., 2008).
7. Chinese S. japonicum DNA vaccine SjCTPI-Hsp70
a. Vaccine Ontology ID:
VO_0004459
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Water buffalo
e. Gene Engineering of TPI
  • Type: DNA vaccine construction
  • Description: This DNA vaccine expressed triose-phosphate isomerase (SjCTPI) fused to bovine heat shock protein 70 (Da'dara et al., 2008).
  • Detailed Gene Information: Click here.
f. Immunization Route
Intramuscular injection (i.m.)
g. Water buffalo Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: This vaccine produced a 51.2% reduction in worm burden, 61.5% liver egg reduction, 52.1% fecal egg reduction and 52.1% reduction in fecal miracidia (Da'dara et al., 2008).
8. rAdV-SjTPI.opt
a. Vaccine Ontology ID:
VO_0004782
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
Replication-defective adenoviral vector-based vaccine with optimized SjTPI (rAdV-SjTPI.opt) (Dai et al., 2014).
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
  • Vaccination Protocol: Mice were randomly divided into different vaccination groups (16 mice/group) for intramuscular (i.m.), subcutaneous (s.c.) and oral immunization (o.i.). Groups consisted of vaccination with the adenoviral vector alone or without vaccination were used as vector or normal control, respectively (Dai et al., 2014).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Each mouse was challenged with 40 ± 1 S. japonicum cercariae by abdominal skin penetration two weeks after the last vaccination (Dai et al., 2014).
  • Efficacy: Results showed that intramuscular rAdV-SjTPI.opt induced Th1 biased immune responses in the host, while subcutaneous rAdV-SjTPI.opt induced Th2 predominant immune responses. Oral rAdV-SjTPI.opt induced low levels of immune responses and no significant protection. Intramuscular rAdV-SjTPI.opt provided a consistent and repeatable higher protective effect in mice (Dai et al., 2014).
9. S. gordonii -M6-Sj-F1
a. Vaccine Ontology ID:
VO_0004668
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Immunization Route
Intramuscular injection (i.m.)
IV. References
1. Balen et al., 2007: Balen J, Zhao ZY, Williams GM, McManus DP, Raso G, Utzinger J, Zhou J, Li YS. Prevalence, intensity and associated morbidity of Schistosoma japonicum infection in the Dongting Lake region, China. Bulletin of the World Health Organization. 2007; 85(7); 519-526. [PubMed: 17768500].
2. Da'dara et al., 2008: Da'dara AA, Li YS, Xiong T, Zhou J, Williams GM, McManus DP, Feng Z, Yu XL, Gray DJ, Harn DA. DNA-based vaccines protect against zoonotic schistosomiasis in water buffalo. Vaccine. 2008; 26(29-30); 3617-3625. [PubMed: 18524429].
3. Gan et al., 2004: Gan Y, Shi YE, Bu LY, Zhu XH, Ning CX, Zhu HG. Immune responses against Schistosoma japonicum after vaccinating mice with a multivalent DNA vaccine encoding integrated membrane protein Sj23 and cytokine interleukin-12. Chinese medical journal. 2004; 117(12); 1842-1846. [PubMed: 15603716].
4. Wei et al., 2009: Wei F, Liu Q, Zhai Y, Fu Z, Liu W, Shang L, Men J, Gao S, Lian H, Jin H, Chen C, Lin J, Shi Y, Xia Z, Zhu XQ. IL-18 enhances protective effect in mice immunized with a Schistosoma japonicum FABP DNA vaccine. Acta tropica. 2009; 111(3); 284-288. [PubMed: 19467215].
5. Zhou et al., 2000: Zhou S, Liu S, Song G, Xu Y, Sun W. Protective immunity induced by the full-length cDNA encoding paramyosin of Chinese Schistosoma japonicum. Vaccine. 2000; 18(27); 3196-3204. [PubMed: 10856799].