VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Infectious pancreatic necrosis virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Introduction
  2. Vaccine Related Pathogen Genes
    1. ORF (Protective antigen)
    2. VP2 (Protective antigen)
  3. Vaccine Information
    1. IPNV DNA vaccine pEGFP-N1-SegA and pEGFP-N1-VP2
  4. References
I. General Information
1. NCBI Taxonomy ID:
11002
2. Introduction
Infectious Pancreatic Necrosis (IPN) is a highly contagious systemic birnavirus disease of young fish of Salmonid species held under intensive rearing conditions. The disease most characteristically occurs in rainbow trout (Oncorhynchus mykiss), brook trout (Salvelinus fontinalis), brown trout (Salmo trutta), Atlantic salmon (Salmo salar) and several Pacific salmon species (Oncorhynchus spp.).

It mostly occurs under intensive rearing conditions in Salmonids hatcheries or in Post-Smolt Atlantic salmon in sea-cages.

The IPN virus is a birnavirus. The original serotype isolated from rainbow trout fingerlings is called VR-299. Since then, several serotypes have been identified and, in 1995, two serogroups, A and B, were established, each containing serotypes with different geographic origins. The most frequently found and virulent serotype is the Sp serotype.

The lethality of the virus depends on the strain, the species and age of the fish. Predisposing stress-inducing factors, such as first feeding, high stocking density, fluctuations in water temperature, salinity and handling, are believed to favour the onset of clinical disease. Outbreaks can occur all year round, at water temperatures as low as 4 ° C and as high as 18 °C.

Infectious Pancreatic Necrosis virus is a bi-segmented double-stranded RNA virus of the family Birnaviridae. At least nine serotypes exist. Susceptibility decreases with increasing age, with complete resistance to clinical disease in fry/fingerlings being reached at about 1500 degree-days (value obtained by multiplying the age in days by the average temperature during the lifespan) except for Atlantic salmon Smolts, which develop the disease within weeks following transfer from freshwater to seawater (Merck - Infectious Pancreatic Necrosis Virus).
1. ORF
  • Gene Name : ORF
  • Sequence Strain (Species/Organism) : Infectious pancreatic necrosis virus
  • NCBI Nucleotide GI : 221910
  • NCBI Protein GI : 221911
  • Protein Accession : BAA00608.1
  • Taxonomy ID : 11002
  • Gene Strand (Orientation) : ?
  • Protein Name : small ORF
  • Protein Note : 5' end of plus-strand segment A.
  • DNA Sequence : Show Sequence
    >gi|221910|dbj|D00701.1|IPNSEGA Infectious pancreatic necrosis virus genes for small ORF, large ORF
    GTGTGTTTGACAGAAAGAGAGTTTCAACGTTAGTGGTAACCCACGAGCGGAGAGCTCTTACGGAGGAGCT
    CTCCGTCGATGGCGAAAGCCCTTTCTAACAAACAAACAAACAATCTATATTCAATACAAGATGAACACAA
    ACAAGGCAACCGCAACTTACTTGAAATCCATTATGCTTCCAGAGACTGGACCAGCAAGCATCCCGGACGA
    CATAACGGAGAGACACATCCTAAAACAAGAGACCTCGTCATACAACCTAGAGGTCTCCGAATCAGGAAGT
    GGCATTCTTGTTTGTTTCCCTGGGGCACCAGGCTCACGGATCGGTGCACACTACAGATGGAATGCGAACC
    AGACGGGGCTGGAGTTCGACCAGTGGCTGGAGACGTCGCAGGACCTGAAGAAAGCCTTCAACTACGGGAG
    GCTGATCTCAAGGAAATACGACATCCAAAGCTCCACACTACCGGCCGGTCTCTATGCTCTGAACGGGACG
    CTCAACGCTGCCACCTTCGAAGGCAGTCTGTCTGAGGTGGAGAGCCTGACCTACAACAGCCTGATGTCCC
    TAACAACGAACCCCCAGGACAAAGTCAACAACCAGCTGGTGACCAAAGGAGTCACAGTCCTGAATCTACC
    AACAGGGTTCGACAAACCATACGTCCGCCTAGAGGACGAGACACCCCAGGGTCTCCAGTCAATGAACGGG
    GCCAAGATGAGGTGCACAGCTGCAATTGCACCGCGGAGGTACGAGATCGACCTCCCATCCCAACGCCTAC
    CCCCCGTTCCTGCGACAGGAACCCTCACCACTCTCTACGAGGGAAACGCCGACATCGTCAACTCCACAAC
    AGTGACGGGAGACATAAACTTCAGTCTGGCAGAACAACCCGCGAACGAGACCAAGTTCGACTTCCAGCTG
    GACTTCATGGGCCTTGACAACGACGTCCCAGTTGTCACAGTGGTCAGCTCCGTGCTGGCCACAAATGACA
    ACTACAGAGGAGTCTCAGCCAAGATGACCCAGTCCATCCCGACCGAGAACATCACAAAGCCGATCACCAG
    GGTCAAGCTGTCATACAAGATCAACCAGCAGACAGCAATCGGCAACGTCGCCACCCTGGGCACAATGGGT
    CCGACTACCGTCTCCTTCTCATCAGGGAACGGAAATGTCCCCGGCGTGCTCAGACCAATCACACTGGTGG
    CCTATGAGAAGATGACACCGCTGTCCATCCTGACCGTAGCTGGAGTGTCCAACTACGAGTCGTACCCAAA
    CCCAGAACTCCTCAAGAACATGGTGACACGCTATGGCAAGTACGACCCCGAAGGTCTCAACTATGCCAAG
    ATGATCCTGTCCCACAGGGAAGAGCTGGACATCAGGACAGTGTGGAGGACAGAGGAGTACAAGGAGAGGA
    CCAGAGTCTTCAACGAAATCACGGACTTCTCCAGTGACCTGCCCACGTCAAAGGCATGGGGCTGGAGAGA
    CATAGTCAGAGGAATTCGGAAAGTCGCAGCTCCTGTACTGTCCACGCTGTTTCCAATGGCAGCACCACTC
    ATAGGAATGGCAGACCAATTCATTGGAGATCTCACCAAGACCAACGCAGCAGGCGGAAGGTACCACTCCA
    TGGCCGCAGGAGGGCGCCACAAAGACGTGCTCGAGTCCTGGGCAAGCGGAGGGCCCGACGGAAAATTCTC
    CCGAGCCCTCAAGAACAGGCTGGAGTCCGCCAACTACGAGGAAGTCGAGCTTCCACCCCCCTCAAAAGGA
    GTCATCGTCCCTGTGGTGCACACAGTCAAGAGTGCACCAGGCGAGGCATTCGGGTCCCTGGCAATCATAA
    TTCCAGGGGAGTACCCCGAGCTTCTAGATGCCAACCAGCAGGTCCTATCCCACTTCGCAAACGACACCGG
    GAGCGTGTGGGGCATAGGAGAGGACATACCCTTCGAGGGAGACAACATGTGCTACACTGCACTCCCACTC
    AAGGAGATCAAAAGAAACGGGAACATAGTAGTCGAGAAGATCTTTGCTGGACCAATCATGGGTCCCTCTG
    CTCAACTAGGACTGTCCCTACTTGTGAACGACATCGAGGACGGAGTTCCAAGGATGGTATTCACCGGCGA
    AATCGCCGATGACGAGGAGACAATCATACCAATCTGCGGTGTAGACATCAAAGCCATCGCAGCCCATGAA
    CCAGGGCTGCCACTCATCGGCAACCAACCAGGAGTGGACGAGGAGGTGCGAAACACATCCCTGGCCGCAC
    ACCTGATCCAGACCGGAACCCTGCCCGTACAACGAGCAAAGGGCTCCAACAAGAGGATCAAGTACCTGGG
    AGAGCTGATGGCATCAAATGCATCCGGGATGGACGAGGAACTGCAACGCCTCCTGAACGCCACAATGGCA
    CGGGCCAAAGAAGTCCAGGACGCCGAGATCTACAAACTTCTTAAGCTCATGGCATGGACCAGAAAGAACG
    ACCTCACCGACCACATGTACGAGTGGTCAAAAGAGGACCCCGATGCACTAAAGTTCGGAAAGCTCATCAG
    CACGCCACCAAAGCACCCTGAGAAGCCCAAAGGACCAGACCAACACCACGCCCAAGAGGCGAGAGCCACC
    CGCATATCACTGGACGCCGTGAGAGCCGGGGCGGACTTCGCCACACCGGAATGGGTCGCGCTGAACAACT
    ACCGCGGCCCATCTCCCGGGCAGTTCAAGTACTACCTGATCACTGGACGAGAACCAGAACCAGGCGACGA
    GTACGAGGACTACATAAAACAACCCATTGTGAAACCGACCGACATGAACAAAATCAGACGTCTAGCCAAC
    AGTGTGTACGGCCTCCCACACCAGGAACCAGCACCAGAGGAGTTCTACGATGCAGTTGCAGCTGTATTCG
    CACAGAACGGAGGCAGAGGTCCCGACCAGGACCAAATGCAAGACCTCAGGGAGCTCGCAAGACAGATGAA
    ACGACGACCCCGGAACGCCGATGCACCACGGAGAACCAGAGCGCCAGCGGAACCGGCACCGCCCGGACGC
    TCAAGGTTCACCCCCAGCGGAGACAACGCTGAGGTGTAACGACTACTCTCTTTCCTGACTGATCCCCTGG
    CCAAAACCCCGGCCCCCCAGGGGG
  • Molecule Role : Protective antigen
  • Related Vaccine(s): IPNV DNA vaccine pEGFP-N1-SegA and pEGFP-N1-VP2
2. VP2
  • Gene Name : VP2
  • Sequence Strain (Species/Organism) : Infectious pancreatic necrosis virus
  • NCBI Protein GI : 262212663
  • Other Database IDs : CDD:110742
  • Taxonomy ID : 11002
  • Gene Strand (Orientation) : ?
  • Protein Name : VP2
  • Protein Length : 260
  • Protein Note : genotype: Sp
  • Protein Sequence : Show Sequence
    >gi|262212663|gb|ACY35990.1| VP2 [Infectious pancreatic necrosis virus]
    MLPETGPASIPDDITERHILKQETSSYNLEVSESGSGILVCFPGAPGSRIGAHYRWNANQTGLEFDQWLE
    TSQDLKKAFNYGRLISRKYDIQSSTLPAGLYALNGTLNAATFEGSLSEVESLTYNSLMSLTTNPQDKVNN
    QLVTKGVTVLNLPTGFDKPYVRLEDETPQGLQSMNGAKMRCTAAIAPRRYEIDLPSQRLPPVPATGALTT
    LYEGNADIVNSTTVTGDINFSLAEQPAVETKFDFQLDFMGLDNDVPVVTV
  • Molecule Role : Protective antigen
  • Related Vaccine(s): IPNV DNA vaccine pEGFP-N1-SegA and pEGFP-N1-VP2
III. Vaccine Information
1. IPNV DNA vaccine pEGFP-N1-SegA and pEGFP-N1-VP2
a. Vaccine Ontology ID:
VO_0004493
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Salmon
e. Gene Engineering of ORF
  • Type: DNA vaccine construction
  • Description: Vector pEGFP-N1 expressed the polyprotein gene (Bases131-3046) and the VP2 gene from strain Rauma (Mikalsen et al., 2004).
  • Detailed Gene Information: Click here.
f. Gene Engineering of VP2
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Vector:
pEGFP-N1 (Mikalsen et al., 2004)
h. Immunization Route
Microinjection
i. Fish Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: A high level of protection was induced (Mikalsen et al., 2004).
IV. References
1. Merck - Infectious Pancreatic Necrosis Virus: Infectious Pancreatic Necrosis [http://aqua.merck-animal-health.com/diseases/infectious-pancreatic-necrosis/productadditional_127_113313.aspx]
2. Mikalsen et al., 2004: Mikalsen AB, Torgersen J, Aleström P, Hellemann AL, Koppang EO, Rimstad E. Protection of atlantic salmon Salmo salar against infectious pancreatic necrosis after DNA vaccination. Diseases of aquatic organisms. 2004; 60(1); 11-20. [PubMed: 15352520].