VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Mycobacterium marinum

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Introduction
  2. Vaccine Related Pathogen Genes
    1. Ag85A (Protective antigen)
  3. Vaccine Information
    1. M. marinum pCMV-85A
  4. References
I. General Information
1. NCBI Taxonomy ID:
1781
2. Introduction
Mycobacterium marinum is an atypical Mycobacterium species found in cold or warm, fresh or salted water. M marinum infection occurs following skin and soft-tissue injuries that are exposed to an aquatic environment or marine animals. The infection usually presents as a localized granuloma but can evolve into an ascending lymphangitis that resembles sporotrichosis or can spread to deeper tissues. M marinum is a pathogen classified in Runyon group 1 and is a photochromogen, meaning it produces pigment when cultured and exposed to light. Culture growth occurs over 7-14 days and is optimal at 32°C (Medscape - Mycobacterium marinum).
1. Ag85A
  • Gene Name : Ag85A
  • Sequence Strain (Species/Organism) : Mycobacterium marinum
  • NCBI Protein GI : 13431282
  • Other Database IDs : CDD:201428
  • Taxonomy ID : 1781
  • Gene Strand (Orientation) : ?
  • Protein Name : Antigen 85-A
  • Protein Length : 139
  • Protein Note : Antigen 85 complex A; Fibronectin-binding protein A; Mycolyl transferase 85A; Ag85A
  • Protein Sequence : Show Sequence
    >gi|13431282|sp|Q9KH57.1|A85A_MYCMR RecName: Full=Antigen 85-A; AltName: Full=Antigen 85 complex A; Short=85A; Short=Ag85A; AltName: Full=Fibronectin-binding protein A; AltName: Full=Mycolyl transferase 85A
    PTGSGVVGLSMAGSSALILAAYHPDQFVYSGSLSALLDPSQGMGPSLIGLAMGDAGGYKASDMWGPKDDP
    AWARNDPMLQVGKLVANNTRIWVYCGNGKPSDLGGDNLPAKFLEGFVRTSNMKFQAAYNAAGGHNAVWN
  • Molecule Role : Protective antigen
  • Related Vaccine(s): M. marinum pCMV-85A
III. Vaccine Information
1. M. marinum pCMV-85A
a. Vaccine Ontology ID:
VO_0004496
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Fish
e. Gene Engineering of Ag85A
  • Type: DNA vaccine construction
  • Description: Vector pcDNA 3.1 expressed Mycobacterium marinum Ag85A gene (Pasnik and Smith, 2005).
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA 3.1 (Pasnik and Smith, 2005)
g. Immunization Route
Intraperitoneal injection (i.p.)
h. Fish Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Fish receiving the DNA vaccine developed a protective response to a live M. marinum challenge 90 days post-inoculation, as demonstrated by increased survival of vaccinated fish over control fish and by reduced splenic bacterial counts in vaccinated fish (Pasnik and Smith, 2005).
IV. References
1. Medscape - Mycobacterium marinum: Mycobacterium Marinum [http://emedicine.medscape.com/article/223363-overview]
2. Pasnik and Smith, 2005: Pasnik DJ, Smith SA. Immunogenic and protective effects of a DNA vaccine for Mycobacterium marinum in fish. Veterinary immunology and immunopathology. 2005; 103(3-4); 195-206. [PubMed: 15621306].