VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Bovine viral diarrhea virus 2

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. E2 (Protective antigen)
  3. Vaccine Information
    1. BVDV DNA vaccine encoding E2
  4. References
I. General Information
1. NCBI Taxonomy ID:
54315
2. Disease:
Bovine viral diarrhea
3. Introduction
Bovine viral diarrheal virus (BVDV), the causal agent of BVD and mucosal disease complex, is classified in the genus Pestivirus in the family Flaviviridae. Although cattle are the primary host for BVDV, several reports suggest most even-toed ungulates are also susceptible. Based on comparisons of nucleotide sequence in the viral RNA, there are at least 2 viral genotypes (distinct genetic groups) of BVDV that can be further divided into subgenotypes or genogroups. The viral genotypes are termed BVDV type 1 and BVDV type 2, and both cytopathic and noncytopathic BVDV are represented in each viral genotype. The subgenotypes are clusters of viruses within a viral genotype that are highly similar in nucleotide sequence of the viral RNA. (Subgenotypes are designated by lower case letters; thus, subgenotypes of genotype 1 BVDV would be represented as 1a, 1b, 1c, etc.) Currently, the number of viral subgenotypes remains unknown. Based on sequence of several hundred nucleotides of select regions of viral RNA, type 1 BVDV has at least 12–15 subgenotypes and type 2 BVDV has at least 2 subgenotypes (Merck Vet Manual: Bovine Viral Diarrhea).
4. Host Ranges and Animal Models
Cows (Merck Vet Manual: Bovine Viral Diarrhea)
1. E2
  • Gene Name : E2
  • Sequence Strain (Species/Organism) : Bovine viral diarrhea virus 2 TC Shinozaki NCP/92
  • NCBI Protein GI : 49614538
  • Taxonomy ID : 54315
  • Gene Strand (Orientation) : ?
  • Protein Name : structural glycoprotein E2
  • Protein Length : 140
  • Protein Note : synonym: Bovine viral diarrhea virus genotype 2; synonym: Bovine viral diarrhea virus-2
  • Protein Sequence : Show Sequence
    >gi|49614538|dbj|BAD27019.1| structural glycoprotein E2 [Bovine viral diarrhea virus 2]
    CTLANQDTLGTTVIRTYRRTTPFQRRKWCAYEKIIGEDIHECILGGNWTCIIGDHSKLKDGPIKKSKWCG
    YDFSSPEGLPHYPIGKCMLSNESGYRYVDDTSCDRGGVAIVPTGTVKCRIGNVTVQVIATNKDLGPMPCS
  • Molecule Role : Protective antigen
  • Related Vaccine(s): BVDV DNA vaccine encoding E2
III. Vaccine Information
1. BVDV DNA vaccine encoding E2
a. Vaccine Ontology ID:
VO_0004538
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Calves
e. Antigen
E2 from BVDV Q140 (van et al., 2013)
f. Gene Engineering of E2
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Vector:
pMASIA (van et al., 2013)
h. Immunization Route
Intramuscular injection (i.m.)
i. Cattle Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Two doses of this vaccine spaced 6 or 12 weeks apart were sufficient to induce significant virus-neutralizing antibody titers, numbers of activated T cells, and reduction in viral shedding and clinical presentations after BVDV-2 challenge. In contrast to the placebo-treated animals, the vaccinated calves did not lose any weight, which is an excellent indicator of the well-being of an animal and has a significant economic impact (van et al., 2013).
IV. References
1. Liang et al., 2008: Liang R, van den Hurk JV, Landi A, Lawman Z, Deregt D, Townsend H, Babiuk LA, van Drunen Littel-van den Hurk S. DNA prime protein boost strategies protect cattle from bovine viral diarrhea virus type 2 challenge. The Journal of general virology. 2008; 89(Pt 2); 453-466. [PubMed: 18198376].
2. Merck Vet Manual: Bovine Viral Diarrhea: Merck Vet Manual: Bovine Viral Diarrhea and Mucosal Disease Complex [http://www.merckmanuals.com/vet/digestive_system/intestinal_diseases_in_ruminants/intestinal_diseases_in_cattle.html#v3263133?qt=&sc=&alt=]
3. van et al., 2013: van Drunen Littel-van den Hurk S, Lawman Z, Snider M, Wilson D, van den Hurk JV, Ellefsen B, Hannaman D. Two doses of bovine viral diarrhea virus DNA vaccine delivered by electroporation induce long-term protective immune responses. Clinical and vaccine immunology : CVI. 2013; 20(2); 166-173. [PubMed: 23220999].