VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Mycobacterium bovis

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
  2. Vaccine Related Pathogen Genes
    1. Ag85B (Protective antigen)
  3. Vaccine Information
    1. Bacillus Calmette-Guérin Danish (BCG)
    2. M. bovis DNA vaccine pCI-Ag85B
  4. References
I. General Information
1. NCBI Taxonomy ID:
1765
2. Disease:
Tuberculosis
1. Ag85B
  • Gene Name : Ag85B
  • Sequence Strain (Species/Organism) : Mycobacterium bovis strain 1173P2
  • NCBI Protein GI : 44168
  • Other Database IDs : CDD:223700
    GOA:A1KJU9
    InterPro: IPR000801
    UniProtKB/UniProt: A1KJU9
  • Taxonomy ID : 1765
  • Gene Strand (Orientation) : ?
  • Protein Name : protein or antigen 85-B
  • Protein Length : 325
  • Protein Note : Predicted esterase [General function prediction only]
  • Protein Sequence : Show Sequence
    >gi|44168|emb|CAA44268.1| protein or antigen 85-B [Mycobacterium bovis]
    MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGG
    NNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETL
    LTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGD
    AGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKF
    QDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
  • Molecule Role : Protective antigen
  • Related Vaccine(s): M. bovis DNA vaccine pCI-Ag85B
III. Vaccine Information
1. Bacillus Calmette-Guérin Danish (BCG)
a. Vaccine Ontology ID:
VO_0004807
b. Type:
Live, attenuated vaccine
c. Status:
Licensed
d. Host Species for Licensed Use:
Baboon
e. Immunization Route
subcutaneous injection
f. Cattle Response
  • Vaccination Protocol: Two groups of calves (n = 9/group) were vaccinated subcutaneously with a lyophilized BCG Danish vaccine containing either 0.5 (1 × 105 to 4 × 105 CFU) or 5 (1 × 106 to 4 × 106 CFU) human doses of BCG Danish, with an additional group of 10 calves serving as non vaccinated controls (Buddle et al., 2013).
  • Challenge Protocol: Intratracheal challenge with 5 × 103 CFU of virulent M. bovis 15 weeks after vaccination (Buddle et al., 2013).
  • Efficacy: Vaccination of the calves with either 0.5 or 5 equivalent human doses of BCG Danish induced similar levels of protection against challenge with M. bovis, with both groups showing significant reductions in the pathological and microbiological parameters compared to those for the the control group (P < 0.05) (Buddle et al., 2013).
2. M. bovis DNA vaccine pCI-Ag85B
a. Vaccine Ontology ID:
VO_0004806
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Host Species as Laboratory Animal Model:
Mouse
f. Gene Engineering of Ag85B
g. Vector:
pCI (Teixeira et al., 2006)
h. Immunization Route
Intramuscular injection (i.m.)
i. Mouse Response
  • Efficacy: Ag85B DNA immunization induced a statistically significant reduction in M. bovis CFU numbers in spleens (log 0.56) compared to what was seen for mice that received the plasmid pCI alone (P < 0.05). However, there was no significant reduction in bacterial load in lungs of pCI-Ag85B-immunized mice compared to the pCI control group (Teixeira et al., 2006).
IV. References
1. Buddle et al., 2013: Buddle BM, Hewinson RG, Vordermeier HM, Wedlock DN. Subcutaneous administration of a 10-fold-lower dose of a commercial human tuberculosis vaccine, Mycobacterium bovis bacillus Calmette-Guerin Danish, induced levels of protection against bovine tuberculosis and responses in the tuberculin intradermal test similar to those induced by a standard cattle dose. Clinical and vaccine immunology : CVI. 2013; 20(10); 1559-1562. [PubMed: 23925885].
2. Teixeira et al., 2006: Teixeira FM, Teixeira HC, Ferreira AP, Rodrigues MF, Azevedo V, Macedo GC, Oliveira SC. DNA vaccine using Mycobacterium bovis Ag85B antigen induces partial protection against experimental infection in BALB/c mice. Clinical and vaccine immunology : CVI. 2006; 13(8); 930-935. [PubMed: 16893994].