VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

MERS-CoV

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
  2. Vaccine Related Pathogen Genes
    1. S from MERS-CoV (Protective antigen)
  3. Vaccine Information
    1. Ad5.MERS-S vaccine
    2. Ad5.MERS-S1 vaccine
    3. England S1 subunit protein vaccine
    4. England1 S DNA + England1 S protein subunit vaccine
    5. England1 S DNA vaccine
    6. Inactivated whole MERS-CoV (IV) vaccine with CpG and Alum
    7. MERS-CoV pcDNA3.1-S1 DNA vaccine
    8. MERS-CoV S vaccine adjuvanted with CpG and Alum
    9. rNTD vaccine
    10. rRBD vaccine
    11. VSVΔG-MERS vaccine
  4. References
I. General Information
1. NCBI Taxonomy ID:
1335626
2. Disease:
Middle East Respiratory Syndrome (MERS)
1. S from MERS-CoV
  • Gene Name : S from MERS-CoV
  • Sequence Strain (Species/Organism) : Middle East respiratory syndrome-related coronavirus
  • NCBI Gene ID : 14254594
  • NCBI Protein GI : 667489389
  • Locus Tag : G128_gp02
  • Protein Accession : YP_009047204
  • Taxonomy ID : 1335626
  • Gene Starting Position : 21455
  • Gene Ending Position : 25516
  • Gene Strand (Orientation) : +
  • Protein Name : spike glycoprotein
  • Protein pI : 5.92
  • Protein Weight : 139840.56
  • Protein Length : 1353
  • DNA Sequence : Show Sequence
    >NC_019843.3:21455-25516 Middle East respiratory syndrome coronavirus, complete genome
    AATGATACACTCAGTGTTTCTACTGATGTTCTTGTTAACACCTACAGAAAGTTACGTTGATGTAGGGCCA
    GATTCTGTTAAGTCTGCTTGTATTGAGGTTGATATACAACAGACTTTCTTTGATAAAACTTGGCCTAGGC
    CAATTGATGTTTCTAAGGCTGACGGTATTATATACCCTCAAGGCCGTACATATTCTAACATAACTATCAC
    TTATCAAGGTCTTTTTCCCTATCAGGGAGACCATGGTGATATGTATGTTTACTCTGCAGGACATGCTACA
    GGCACAACTCCACAAAAGTTGTTTGTAGCTAACTATTCTCAGGACGTCAAACAGTTTGCTAATGGGTTTG
    TCGTCCGTATAGGAGCAGCTGCCAATTCCACTGGCACTGTTATTATTAGCCCATCTACCAGCGCTACTAT
    ACGAAAAATTTACCCTGCTTTTATGCTGGGTTCTTCAGTTGGTAATTTCTCAGATGGTAAAATGGGCCGC
    TTCTTCAATCATACTCTAGTTCTTTTGCCCGATGGATGTGGCACTTTACTTAGAGCTTTTTATTGTATTC
    TAGAGCCTCGCTCTGGAAATCATTGTCCTGCTGGCAATTCCTATACTTCTTTTGCCACTTATCACACTCC
    TGCAACAGATTGTTCTGATGGCAATTACAATCGTAATGCCAGTCTGAACTCTTTTAAGGAGTATTTTAAT
    TTACGTAACTGCACCTTTATGTACACTTATAACATTACCGAAGATGAGATTTTAGAGTGGTTTGGCATTA
    CACAAACTGCTCAAGGTGTTCACCTCTTCTCATCTCGGTATGTTGATTTGTACGGCGGCAATATGTTTCA
    ATTTGCCACCTTGCCTGTTTATGATACTATTAAGTATTATTCTATCATTCCTCACAGTATTCGTTCTATC
    CAAAGTGATAGAAAAGCTTGGGCTGCCTTCTACGTATATAAACTTCAACCGTTAACTTTCCTGTTGGATT
    TTTCTGTTGATGGTTATATACGCAGAGCTATAGACTGTGGTTTTAATGATTTGTCACAACTCCACTGCTC
    ATATGAATCCTTCGATGTTGAATCTGGAGTTTATTCAGTTTCGTCTTTCGAAGCAAAACCTTCTGGCTCA
    GTTGTGGAACAGGCTGAAGGTGTTGAATGTGATTTTTCACCTCTTCTGTCTGGCACACCTCCTCAGGTTT
    ATAATTTCAAGCGTTTGGTTTTTACCAATTGCAATTATAATCTTACCAAATTGCTTTCACTTTTTTCTGT
    GAATGATTTTACTTGTAGTCAAATATCTCCAGCAGCAATTGCTAGCAACTGTTATTCTTCACTGATTTTG
    GATTACTTTTCATACCCACTTAGTATGAAATCCGATCTCAGTGTTAGTTCTGCTGGTCCAATATCCCAGT
    TTAATTATAAACAGTCCTTTTCTAATCCCACATGTTTGATTTTAGCGACTGTTCCTCATAACCTTACTAC
    TATTACTAAGCCTCTTAAGTACAGCTATATTAACAAGTGCTCTCGTCTTCTTTCTGATGATCGTACTGAA
    GTACCTCAGTTAGTGAACGCTAATCAATACTCACCCTGTGTATCCATTGTCCCATCCACTGTGTGGGAAG
    ACGGTGATTATTATAGGAAACAACTATCTCCACTTGAAGGTGGTGGCTGGCTTGTTGCTAGTGGCTCAAC
    TGTTGCCATGACTGAGCAATTACAGATGGGCTTTGGTATTACAGTTCAATATGGTACAGACACCAATAGT
    GTTTGCCCCAAGCTTGAATTTGCTAATGACACAAAAATTGCCTCTCAATTAGGCAATTGCGTGGAATATT
    CCCTCTATGGTGTTTCGGGCCGTGGTGTTTTTCAGAATTGCACAGCTGTAGGTGTTCGACAGCAGCGCTT
    TGTTTATGATGCGTACCAGAATTTAGTTGGCTATTATTCTGATGATGGCAACTACTACTGTTTGCGTGCT
    TGTGTTAGTGTTCCTGTTTCTGTCATCTATGATAAAGAAACTAAAACCCACGCTACTCTATTTGGTAGTG
    TTGCATGTGAACACATTTCTTCTACCATGTCTCAATACTCCCGTTCTACGCGATCAATGCTTAAACGGCG
    AGATTCTACATATGGCCCCCTTCAGACACCTGTTGGTTGTGTCCTAGGACTTGTTAATTCCTCTTTGTTC
    GTAGAGGACTGCAAGTTGCCTCTTGGTCAATCTCTCTGTGCTCTTCCTGACACACCTAGTACTCTCACAC
    CTCGCAGTGTGCGCTCTGTTCCAGGTGAAATGCGCTTGGCATCCATTGCTTTTAATCATCCTATTCAGGT
    TGATCAACTTAATAGTAGTTATTTTAAATTAAGTATACCCACTAATTTTTCCTTTGGTGTGACTCAGGAG
    TACATTCAGACAACCATTCAGAAAGTTACTGTTGATTGTAAACAGTACGTTTGCAATGGTTTCCAGAAGT
    GTGAGCAATTACTGCGCGAGTATGGCCAGTTTTGTTCCAAAATAAACCAGGCTCTCCATGGTGCCAATTT
    ACGCCAGGATGATTCTGTACGTAATTTGTTTGCGAGCGTGAAAAGCTCTCAATCATCTCCTATCATACCA
    GGTTTTGGAGGTGACTTTAATTTGACACTTCTAGAACCTGTTTCTATATCTACTGGCAGTCGTAGTGCAC
    GTAGTGCTATTGAGGATTTGCTATTTGACAAAGTCACTATAGCTGATCCTGGTTATATGCAAGGTTACGA
    TGATTGCATGCAGCAAGGTCCAGCATCAGCTCGTGATCTTATTTGTGCTCAATATGTGGCTGGTTACAAA
    GTATTACCTCCTCTTATGGATGTTAATATGGAAGCCGCGTATACTTCATCTTTGCTTGGCAGCATAGCAG
    GTGTTGGCTGGACTGCTGGCTTATCCTCCTTTGCTGCTATTCCATTTGCACAGAGTATCTTTTATAGGTT
    AAACGGTGTTGGCATTACTCAACAGGTTCTTTCAGAGAACCAAAAGCTTATTGCCAATAAGTTTAATCAG
    GCTCTGGGAGCTATGCAAACAGGCTTCACTACAACTAATGAAGCTTTTCAGAAGGTTCAGGATGCTGTGA
    ACAACAATGCACAGGCTCTATCCAAATTAGCTAGCGAGCTATCTAATACTTTTGGTGCTATTTCCGCCTC
    TATTGGAGACATCATACAACGTCTTGATGTTCTCGAACAGGACGCCCAAATAGACAGACTTATTAATGGC
    CGTTTGACAACACTAAATGCTTTTGTTGCACAGCAGCTTGTTCGTTCCGAATCAGCTGCTCTTTCCGCTC
    AATTGGCTAAAGATAAAGTCAATGAGTGTGTCAAGGCACAATCCAAGCGTTCTGGATTTTGCGGTCAAGG
    CACACATATAGTGTCCTTTGTTGTAAATGCCCCTAATGGCCTTTACTTCATGCATGTTGGTTATTACCCT
    AGCAACCACATTGAGGTTGTTTCTGCTTATGGTCTTTGCGATGCAGCTAACCCTACTAATTGTATAGCCC
    CTGTTAATGGCTACTTTATTAAAACTAATAACACTAGGATTGTTGATGAGTGGTCATATACTGGCTCGTC
    CTTCTATGCACCTGAGCCCATTACCTCCCTTAATACTAAGTATGTTGCACCACAGGTGACATACCAAAAC
    ATTTCTACTAACCTCCCTCCTCCTCTTCTCGGCAATTCCACCGGGATTGACTTCCAAGATGAGTTGGATG
    AGTTTTTCAAAAATGTTAGCACCAGTATACCTAATTTTGGTTCCCTAACACAGATTAATACTACATTACT
    CGATCTTACCTACGAGATGTTGTCTCTTCAACAAGTTGTTAAAGCCCTTAATGAGTCTTACATAGACCTT
    AAAGAGCTTGGCAATTATACTTATTACAACAAATGGCCGTGGTACATTTGGCTTGGTTTCATTGCTGGGC
    TTGTTGCCTTAGCTCTATGCGTCTTCTTCATACTGTGCTGCACTGGTTGTGGCACAAACTGTATGGGAAA
    ACTTAAGTGTAATCGTTGTTGTGATAGATACGAGGAATACGACCTCGAGCCGCATAAGGTTCATGTTCAC
    TA
  • Protein Sequence : Show Sequence
    >YP_009047204.1 spike glycoprotein [Middle East respiratory syndrome-related coronavirus]
    MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGIIYPQGRTYSNITIT
    YQGLFPYQGDHGDMYVYSAGHATGTTPQKLFVANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATI
    RKIYPAFMLGSSVGNFSDGKMGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTP
    ATDCSDGNYNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGGNMFQ
    FATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIRRAIDCGFNDLSQLHCS
    YESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSV
    NDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTT
    ITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGST
    VAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVGVRQQRF
    VYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHISSTMSQYSRSTRSMLKRR
    DSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPDTPSTLTPRSVRSVPGEMRLASIAFNHPIQV
    DQLNSSYFKLSIPTNFSFGVTQEYIQTTIQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANL
    RQDDSVRNLFASVKSSQSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYD
    DCMQQGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPFAQSIFYRL
    NGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFQKVQDAVNNNAQALSKLASELSNTFGAISAS
    IGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVRSESAALSAQLAKDKVNECVKAQSKRSGFCGQG
    THIVSFVVNAPNGLYFMHVGYYPSNHIEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSS
    FYAPEPITSLNTKYVAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLL
    DLTYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCCTGCGTNCMGK
    LKCNRCCDRYEEYDLEPHKVHVH
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : MERS-CoV S spike protein is a protective antigen (Deng et al., 2018).
  • Related Vaccine(s): England1 S DNA vaccine , MERS-CoV pcDNA3.1-S1 DNA vaccine , MERS-CoV S vaccine adjuvanted with CpG and Alum , rNTD vaccine , rRBD vaccine
III. Vaccine Information
1. Ad5.MERS-S vaccine
a. Type:
Recombinant vector vaccine
b. Status:
Research
c. Host Species for Licensed Use:
Mouse
d. Host Species as Laboratory Animal Model:
mouse
e. Antigen
S from MERS-CoV(Kim et al., 2014).
f. Immunization Route
Intramuscular injection (i.m.)
g. Description
Recombinant adenoviral vector encoding the full-length MERS-CoV S protein (Ad5.MERS-S) (Kim et al., 2014)
2. Ad5.MERS-S1 vaccine
a. Type:
Recombinant vector vaccine
b. Status:
Research
c. Host Species for Licensed Use:
Mouse
d. Antigen
S1 subunit of S from MERS-CoV (Kim et al., 2014).
e. Immunization Route
Intramuscular injection (i.m.)
f. Description
Recombinant adenoviral vector encoding the the S1 extracellular domain of S protein (Ad5.MERS-S1). (Kim et al., 2014; Kim et al., 2014)
3. England S1 subunit protein vaccine
a. Type:
Subunit vaccine
b. Status:
Research
c. Host Species for Licensed Use:
Baboon
d. Host Species as Laboratory Animal Model:
mouse, rhesus monkey
e. Antigen
S1 subunit of S from MERS-CoV. (Wang et al., 2015)
f. Immunization Route
Intramuscular injection (i.m.)
g. Description
A DNA vaccine constructed from a plasmid vaccines that encoded S1 subunit only. (Wang et al., 2015)
4. England1 S DNA + England1 S protein subunit vaccine
a. Type:
Mixed, DNA vaccine and Subunit vaccine
b. Status:
Research
c. Host Species for Licensed Use:
Baboon
d. Host Species as Laboratory Animal Model:
mouse, rhesus monkey
e. Immunization Route
Intramuscular injection (i.m.)
f. Description
A mixed vaccine using England S1 subunit protein vaccine and England1 S DNA vaccine. VRC8400 plasmid used to construct antigen (Wang et al., 2015)
5. England1 S DNA vaccine
a. Type:
DNA vaccine
b. Status:
Research
c. Host Species for Licensed Use:
Baboon
d. Host Species as Laboratory Animal Model:
mouse, rhesus monkey
e. Antigen
S from MERS-CoV (Wang et al., 2015)
f. Gene Engineering of S from MERS-CoV
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
A DNA vaccine constructed from a plasmid vaccines that encoded full-length, membrane-anchored Spike protein. VRC8400 plasmid used to construct antigen (Wang et al., 2015)
6. Inactivated whole MERS-CoV (IV) vaccine with CpG and Alum
a. Type:
Inactivated or "killed" vaccine
b. Status:
Research
c. Host Species for Licensed Use:
Baboon
d. Host Species as Laboratory Animal Model:
mouse
e. Antigen
whole virus (Deng et al., 2018)
f. Immunization Route
Intramuscular injection (i.m.)
g. Description
inactivated whole MERS-CoV (IV) with a combined adjuvant (alum+CpG) as a vaccine formulation caused protection (Deng et al., 2018).
7. MERS-CoV pcDNA3.1-S1 DNA vaccine
a. Type:
DNA vaccine
b. Status:
Research
c. Host Species for Licensed Use:
Baboon
d. Host Species as Laboratory Animal Model:
mouse
e. Antigen
S from MERS-CoV (Chen et al., 2017)
f. Gene Engineering of S from MERS-CoV
  • Type: DNA vaccine construction
  • Description: Plasmid created containing first 735 amino acids of S from MERS-CoV (Chen et al., 2017)
  • Detailed Gene Information: Click here.
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
DNA vaccine encoding the first 725 amino acids of S from MERS-CoV induces antigen-specific humoral and cellular immune responses in mice (Chen et al., 2017)
8. MERS-CoV S vaccine adjuvanted with CpG and Alum
a. Type:
Live, attenuated vaccine
b. Status:
Licensed
c. Host Species for Licensed Use:
Baboon
d. Host Species as Laboratory Animal Model:
mouse
e. Gene Engineering of S from MERS-CoV
  • Type: Recombinant protein preparation
  • Description: The S spike protein was conjugated with CpG or Alum as a subunit MERS vaccine (Deng et al., 2018).
  • Detailed Gene Information: Click here.
f. Immunization Route
Intramuscular injection (i.m.)
g. Description
The spike protein of middle east respiratory syndrome coronavirus adjuvanted with CpG and/or Alum provided protection against infection of MERS-CoV (Deng et al., 2018).
9. rNTD vaccine
a. Type:
Subunit vaccine
b. Status:
Research
c. Host Species for Licensed Use:
Baboon
d. Host Species as Laboratory Animal Model:
mouse
e. Antigen
Recombinant N-terminal domain (amino acids 18 - 353) of S1 subunit of S protein. (Chen et al., 2017)
f. Gene Engineering of S from MERS-CoV
  • Type: Recombinant protein preparation
  • Description: baculovirus-insect cell sf9-derived recombinant MERS-CoV was used to express rNTD (Chen et al., 2017)
  • Detailed Gene Information: Click here.
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
neutralizing monoclonal antibodiesagainst MERS-CoV which bind to the N-terminal domain (NTD) of the MERS-CoV S1 subunit (Chen et al., 2017)
10. rRBD vaccine
a. Type:
Subunit vaccine
b. Status:
Research
c. Host Species for Licensed Use:
Baboon
d. Host Species as Laboratory Animal Model:
mouse
e. Antigen
Recombinant ribosomal binding site of S1 subunit of S from MERS-COV.(Chen et al., 2017)
f. Gene Engineering of S from MERS-CoV
  • Type: Recombinant protein preparation
  • Description: baculovirus-insect cell sf9-derived recombinant MERS-CoV was used to express rRBD (Chen et al., 2017)
  • Detailed Gene Information: Click here.
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
monoclonal antibody of MERS-CoV, which mapped to a wide range of regions on the spike (S) protein of the virus. In addition to mAbs with neutralizing epitopes located on the receptor-binding domain
11. VSVΔG-MERS vaccine
a. Type:
Recombinant vector vaccine
b. Status:
Research
c. Host Species for Licensed Use:
Baboon
d. Host Species as Laboratory Animal Model:
mouse
e. Antigen
S from MERS-CoV (Liu et al., 2018)
f. Vector:
vesicular stomatitis virus (Liu et al., 2018)
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
Chimeric virus based on the vesicular stomatitis virus (VSV) in which the G gene was replaced by MERS-CoV S gene (VSVΔG-MERS) (Liu et al., 2018)
IV. References
1. Chen et al., 2017: Chen Y, Lu S, Jia H, Deng Y, Zhou J, Huang B, Yu Y, Lan J, Wang W, Lou Y, Qin K, Tan W. A novel neutralizing monoclonal antibody targeting the N-terminal domain of the MERS-CoV spike protein. Emerging microbes & infections. 2017; 6(5); e37. [PubMed: 28536429].
2. Chi et al., 2017: Chi H, Zheng X, Wang X, Wang C, Wang H, Gai W, Perlman S, Yang S, Zhao J, Xia X. DNA vaccine encoding Middle East respiratory syndrome coronavirus S1 protein induces protective immune responses in mice. Vaccine. 2017; 35(16); 2069-2075. [PubMed: 28314561].
3. Deng et al., 2018: Deng Y, Lan J, Bao L, Huang B, Ye F, Chen Y, Yao Y, Wang W, Qin C, Tan W. Enhanced protection in mice induced by immunization with inactivated whole viruses compare to spike protein of middle east respiratory syndrome coronavirus. Emerging microbes & infections. 2018; 7(1); 60. [PubMed: 29618723].
4. Kim et al., 2014: Kim E, Okada K, Kenniston T, Raj VS, AlHajri MM, Farag EA, AlHajri F, Osterhaus AD, Haagmans BL, Gambotto A. Immunogenicity of an adenoviral-based Middle East Respiratory Syndrome coronavirus vaccine in BALB/c mice. Vaccine. 2014; 32(45); 5975-5982. [PubMed: 25192975].
5. Liu et al., 2018: Liu R, Wang J, Shao Y, Wang X, Zhang H, Shuai L, Ge J, Wen Z, Bu Z. A recombinant VSV-vectored MERS-CoV vaccine induces neutralizing antibody and T cell responses in rhesus monkeys after single dose immunization. Antiviral research. 2018; 150; 30-38. [PubMed: 29246504].
6. Wang et al., 2015: Wang L, Shi W, Joyce MG, Modjarrad K, Zhang Y, Leung K, Lees CR, Zhou T, Yassine HM, Kanekiyo M, Yang ZY, Chen X, Becker MM, Freeman M, Vogel L, Johnson JC, Olinger G, Todd JP, Bagci U, Solomon J, Mollura DJ, Hensley L, Jahrling P, Denison MR, Rao SS, Subbarao K, Kwong PD, Mascola JR, Kong WP, Graham BS. Evaluation of candidate vaccine approaches for MERS-CoV. Nature communications. 2015; 6; 7712. [PubMed: 26218507].